KEGG   Alistipes finegoldii: Alfi_1406Help
Entry
Alfi_1406         CDS       T02133                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
afd  Alistipes finegoldii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:afd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1552761..1553252)
Genome map
AA seq 163 aa AA seqDB search
MARVVLLTGGNSGDVKRTLQAAQQLVNAKVGAVLRCSHRYETKPWGFDADGVFSNQALEV
STDLLPLEVLDAVQAIERELGRNRAAEAVEKARTGVNYTSRPIDIDILFYDDEVIDSERL
TVPHPLMGEREFALVPLCEIMRQRRHPVTGRTVGEMLEELRNK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtgtagtacttttgaccggcggcaattccggtgatgtgaaacggacgcttcag
gcggcccagcagctcgtcaacgcgaaggtcggcgccgtgctgcgctgttcgcaccgctac
gaaaccaagccttggggcttcgacgccgacggggttttctccaatcaggcgctggaggtc
tcgaccgacctgctgcctttggaagtgctcgacgccgtgcaggccatcgaacgggagttg
ggccgcaaccgcgccgccgaagctgtcgagaaagcccgcacgggcgtgaactatacctcg
cggccgatcgatatcgacatcctcttctacgacgacgaggtgatcgacagcgaacgcctt
accgtgccgcatccgctcatgggcgaacgggagttcgcactcgtgccgctctgcgagatc
atgcgccagcgccgccatccggttacggggcggaccgtgggggagatgctcgaagagctt
cgtaacaagtaa

DBGET integrated database retrieval system