KEGG   Alistipes finegoldii: Alfi_1440Help
Entry
Alfi_1440         CDS       T02133                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
afd  Alistipes finegoldii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:afd00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:afd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1590602..1592059
Genome map
AA seq 485 aa AA seqDB search
MKTLKELLRNTPVTALHGDDSAAVAGLVYDSRAIGPGDCFFAVRGTQNDGHDFIPAAVAK
GAAAVVCERLPEQTAADVTYVAVPDAAGALADMAAAFYDHPSRALKLVGITGTNGKTTTV
TLLYDLVRALGHKAGLISTVVYKVGERTVEATHTTPDPVRLNAMMREMADEGCEYCFMEC
SSHAIVQERTRGLHFAGGIFSNITHDHLDYHKTFAEYIRAKKLFFDSLSKEAFALTNADD
KNGRVMVQNTAAAIHTYSLRSMADFRCKIVEMHPDGMLLRIDGQEVWVGLVGRFNAYNLL
AVYGAAVLLGFDRGETLRAASMLHPVSGRFELVRSANGVTAVVDYAHTPDALENVIRTIE
EIRTPAQKLIVVCGCGGDRDRTKRPEMAQIAVRYADTAVFTSDNPRHESPEAILDQMAAG
LEPGARFLRIADRAEAIRTAVMLSQPGDILLVAGKGHETYQIVGDVKHPFDDREEVRKAF
DSFGK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactgaaagaacttctccgaaatacccccgtcacggcactgcacggcgacgat
tcggccgccgtcgccgggttggtttacgactcgcgtgccatcgggccgggcgactgcttc
ttcgccgtgcgcggcacgcagaacgacgggcacgacttcattcccgccgccgtcgcaaaa
ggcgccgccgccgtcgtctgcgaacgcctgcccgaacagaccgccgcagacgtcacctac
gtcgcggtgcccgacgccgcaggcgcgctggccgacatggccgcggcgttctacgaccac
cccagccgcgcgctgaaactcgtcggcatcaccggcaccaacggcaagaccacgaccgtg
acgctgctgtatgacctcgtacgggcgttgggtcataaggcgggactgatttcgaccgtg
gtctacaaggtcggcgaacgcaccgtcgaggcgacgcacaccacgcccgaccccgtgcgg
ctcaacgccatgatgcgcgaaatggccgacgaggggtgcgagtactgcttcatggagtgt
tcgtcgcacgccatcgtgcaggagcgcacgcgcgggctgcacttcgcgggcggcatcttc
tcgaacatcacccacgaccacctcgactaccacaagaccttcgccgaatacatccgcgcc
aagaaactcttcttcgactcactctcaaaagaggccttcgcgctgaccaacgccgatgac
aaaaacggccgcgtgatggtgcagaacaccgccgcagccatacacacctactcgctgcgc
tcgatggccgacttccgctgcaagatcgtcgaaatgcacccggacggcatgctgctgcgc
atcgacggacaggaggtatgggtcgggctggtgggccgcttcaacgcctacaacctgctg
gccgtatacggcgcggcggttctgctgggcttcgaccgcggcgaaacgctgcgcgcggcg
agcatgctgcacccggtcagcggccgcttcgaactggtccggagcgcaaacggcgtcacg
gccgtcgtcgattacgcccacacgcccgacgcgctcgaaaacgtgatccgcaccatcgag
gagatccgcaccccggcgcagaagctgatcgtcgtctgcggctgcggcggcgaccgcgac
cgcaccaagcggcccgaaatggcgcagatcgccgtgcggtacgccgacacggccgtcttc
acgtcggacaatccgcgccacgagtcgcccgaagcgattctcgaccagatggcggcggga
ctcgaacccggcgcgcgcttcctgcgcatcgccgaccgcgccgaagccatccgcacggcg
gtgatgctctcgcagccgggcgacatcctgctcgtggcgggcaagggccacgaaacctat
cagatcgtcggcgacgtgaaacaccccttcgacgaccgggaggaggtccgcaaagccttt
gattcattcggtaaataa

DBGET integrated database retrieval system