KEGG   Alistipes finegoldii: Alfi_1455Help
Entry
Alfi_1455         CDS       T02133                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
afd  Alistipes finegoldii
Pathway
afd00260  Glycine, serine and threonine metabolism
afd00750  Vitamin B6 metabolism
afd01100  Metabolic pathways
afd01110  Biosynthesis of secondary metabolites
afd01120  Microbial metabolism in diverse environments
afd01230  Biosynthesis of amino acids
Module
afd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alfi_1455
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Alfi_1455
Enzymes [BR:afd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Alfi_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFL77798
UniProt: I3YLD0
Position
complement(1607559..1608848)
Genome map
AA seq 429 aa AA seqDB search
MKYYSTRDKAHARPCSLREAVEAGLAPDGGLFVPERIPQADMAVAERLAGESYAALAGYL
AALFFGEDIDAGILQREIGRIYDFQVPLRPVGSRYTLELFHGPTFAFKDFGAGFMGRMVG
LLGGADEKLVILTATSGDTGSAVAHGFYNVPGVEVVLLYPEGKISRLQECQMTALGGNIH
PLRVGGTFDDCQRLVKELFADSSFRAAHRVSSANSINLLRWIPQAFYYFYGYFRWRQAAG
GESPVVVVPSGNYGNLSAGMLARRMGLPLGGFVAASNANDVVPEFLRTGDYRPRPSVRTL
ANAMDVGAPSNFERMMWLCGGDADALRGELLGFRCDDAMIRRTIDGLYRNYGYLSDPHSA
VGYAASVACGRPGFYLSTAHPAKFGEVISPVTGAKVPLPPRLAELVKRPRVSEPMAVDLG
ALEEYVAGV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactacagcacgagagacaaagcacatgcacggccctgttctctgcgcgaagcc
gtcgaggcggggctggcgcccgacgggggactgttcgtccccgaacgtattccgcaggct
gatatggcggtcgcggagcggctggccggggaatcctatgccgcattggcggggtatctg
gccgcactgttcttcggcgaggatatcgacgccgggattttgcagcgcgagatcggccgc
atctacgattttcaggttcccctgcgtccggtcggcagccgctatacgctggagctgttc
cacggcccgacgttcgcgttcaaggacttcggcgccggattcatgggccgcatggtcggc
ctgctgggcggcgcggatgaaaagctggtgatcctgacggcgacgtcgggcgatacgggc
agcgccgtggcgcacggtttctacaacgtgccgggcgtcgaggtggtgctgctctatccc
gaagggaagatcagccgcctgcaggagtgtcagatgaccgcgctcggaggcaatatccat
ccgctgcgcgtgggcggaaccttcgacgactgccagcggctggtcaaggagctgttcgcc
gacagctctttcagggccgcacaccgcgtatcgtcggccaattcgatcaacctgctgcgg
tggattccgcaggcgttctattacttctacgggtatttccggtggcggcaggcggcgggc
ggcgaaagtccggtggtcgtggtgccgagcggcaactacggcaacctctcggccggcatg
ctggcgcgccgcatggggctgcccctcggcggattcgtcgcggcgtcgaacgccaacgac
gtggtgcctgaattcctgcggacgggcgattaccgtccgcggccgtcggtgcggacgctg
gccaatgcgatggacgtcggagcgccgagcaacttcgagcggatgatgtggctgtgcggc
ggcgatgcggacgccctgcgcggcgaattgctggggttccggtgcgacgacgccatgatc
cgccgtacgatcgacgggctgtaccggaattacggttatctgtccgatccgcacagcgcc
gtgggctatgcggcttccgtggcctgcggcaggccggggttttacctttcgacggcccat
ccggccaagttcggcgaggtcatttcgcccgtgaccggggcgaaggtgccgttgcctccg
cgccttgcggagctggtgaagcgtccgcgggtttcggagccgatggcggtggatcttggg
gcgctggaggagtacgtcgccggagtgtga

DBGET integrated database retrieval system