KEGG   Alistipes finegoldii: Alfi_1504Help
Entry
Alfi_1504         CDS       T02133                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
afd  Alistipes finegoldii
Pathway
afd00790  Folate biosynthesis
afd01100  Metabolic pathways
Module
afd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Alfi_1504
Enzymes [BR:afd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Alfi_1504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AFL77847
UniProt: I3YLH9
Position
complement(1675550..1676158)
Genome map
AA seq 202 aa AA seqDB search
MEERTYNKEERFDARTIEALKLHYAEILRLLGEDPSREGLLKTPERVAKAMAFLTKGYEE
NPLEIIRSATFREEYKQMVLVKDIELYSLCEHHMLPFYGKAHVAYIPNGHITGLSKIARV
VECYARRLQVQERLTVQIRDCIQEALNPMGVAVVIEASHMCMQMRGIEKQQSATTTSAFT
GIFLSDHRTREEFMTLISHKYR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaagagagaacttacaacaaagaggaacgtttcgacgcccggaccatcgaggcgctg
aagctccattacgccgaaatcctgcggctgctgggggaggacccttcgcgcgaaggactt
ctgaaaacccccgaacgcgtcgccaaggcgatggcgttcctgacgaagggatacgaagag
aatccgctcgaaatcatccgctccgcgacgttccgcgaagagtacaaacagatggtgctc
gtgaaggacatcgagctgtactcgctctgcgaacaccatatgctgccgttttacggcaag
gcgcacgtcgcctacatccccaacggacacatcacgggactttccaaaatcgcccgcgtc
gtggagtgctacgcccgccgcctgcaggtgcaggagcggctgacggtgcagatccgcgac
tgcatacaggaggcgctcaacccgatgggcgtggccgtggtgatcgaggccagccacatg
tgcatgcagatgcgcggcatcgaaaaacagcagtcggcgacgaccacgtcggcgttcacg
ggcattttcctctcggaccaccgcacgcgcgaggagttcatgaccctcatatcgcacaaa
taccggtag

DBGET integrated database retrieval system