KEGG   Alistipes finegoldii: Alfi_1529Help
Entry
Alfi_1529         CDS       T02133                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
afd  Alistipes finegoldii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Alfi_1529
  Lipid metabolism
   00561 Glycerolipid metabolism
    Alfi_1529
   00600 Sphingolipid metabolism
    Alfi_1529
Enzymes [BR:afd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Alfi_1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1700880..1703087)
Genome map
AA seq 735 aa AA seqDB search
MKKLLKPLFTALFAGMVCTGAKAAEPQVINIRTNDLSMVMSVAPNGEVLFHHFGGRIDDA
SPAAGIKSYRRTDHGTDNLAYSTMGGRNFREPALRVTHADGDMNTELRYVSHATRTLADK
NVSETVVKLTDTNQALDVELVYTAYAKENVITTHTVIRNREKGDAVLHAFYSSSLPVKAR
SYLLTHLYGSWARESQTDHTLLTHGSKSIESRKLVRTTHTENPAFMVTLDSEAFDENYGE
VIAGALAWSGNFRLNFEVDEFNVLNILAGVNPYASDYTLAKGESFTTPEMVYTYSFEGAG
GASRSLHDWARNYGVWHGHTYAPTLLNSWEGAYFTFDAKTLTDMIDDAADMGLEMFVLDD
GWFGNKYPRNDANAGLGDWQINAKKLPEGIDYIASHAHRKGLKFGIWIEPEMVNPKSELA
EKHPDWIVRSGDREMPRMRNQWLLDLTNPKVQDFVFSVFDNTMKLSPNIDYIKWDANRHA
ENAGSEFLPKDRQSHFWIDYVQGFYKVMERIRAKYPDVLIQACASGGGRVEYGAMKYFNE
VWTSDNTEALSRARIQYGTSLFYPATVMGSHVSATPNHQTSNITPIKFRFDMACAGRLGM
ELQPKQMNAEEKAFARKAIESYKGYRDIVMEGDLYRIGTPYDDTGYYGVMYVSKDKKKAV
LFTYCTLYQSRTLVPKYRLYGLDAQTRYKIREQNVDKKRFWFDGGTFTGEYLNHAGINPN
LNKIYDSAVFVLEAE
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgctgaaaccgctcttcacggccctgttcgcgggcatggtctgcaccggc
gccaaggccgccgaaccgcaggtcatcaacatccggaccaacgacctttcgatggtcatg
agcgtcgctccgaacggcgaagtgctgttccaccacttcggaggacgcatcgacgacgca
tcgcccgccgcaggcatcaaaagctaccgccgcacggaccacggcaccgacaacctcgcc
tactcgacgatgggcggccgcaacttccgcgaacccgcgctgcgcgtgacccacgccgac
ggggacatgaacaccgaactgcgttacgtgtcgcacgccacgcgcacgctggccgacaag
aacgtcagcgaaacggtcgtcaaactcaccgacaccaatcaggcgctggacgtcgaactg
gtctatacggcctatgccaaagagaacgtcatcacgacccacaccgtgatccgcaaccgc
gaaaagggcgacgccgtactgcacgccttctattcgtcgtcgctgcccgtaaaggcgcgc
agctacctgctgacccacctctacggctcatgggcgcgcgagagccagaccgaccacacg
ctgctcacccacggctcgaagagcatcgagtcgcgcaagctggtgcgcacgacgcacacc
gagaacccggccttcatggtcacgctcgacagcgaagccttcgacgagaactacggcgag
gtgatcgccggcgcgctggcatggagcggcaacttccggctcaacttcgaggtcgatgaa
ttcaacgtgctcaacatcctcgcgggagtcaacccctacgcttcggattacacgctcgcc
aagggcgaatcgttcaccacgcccgaaatggtctacacctacagcttcgagggcgcaggc
ggcgcgagccgcagcctgcacgactgggcgcgcaactacggcgtatggcacggccatacg
tacgccccgacgctgctcaacagctgggagggcgcctacttcacgttcgacgccaagacc
ctgacggacatgatcgacgacgcggcggacatgggactggaaatgttcgtgctggacgac
ggatggttcggcaacaaatatccgcgcaacgatgcgaacgccggactcggcgactggcag
atcaacgcaaaaaaactccccgaaggcatcgactacatcgcttcgcacgcacaccgcaaa
gggctgaaattcggcatctggatcgagccggagatggtcaaccccaagagcgaactggcc
gagaaacatcctgactggatcgtcaggtcgggcgaccgcgaaatgccccggatgcgcaac
cagtggctgctggacctgaccaaccccaaggtgcaggacttcgtattctcggtattcgac
aacacgatgaagctctcgcccaacatcgactacatcaaatgggacgccaaccgccatgcg
gagaacgccggatcggaattcctgcccaaagacaggcagtcgcacttctggatcgactat
gtgcagggattctacaaggtcatggagcgcatccgcgccaaatatcccgacgtgctgatc
caagcctgcgcttcgggcggcggccgcgtggagtacggcgcgatgaagtacttcaacgag
gtgtggaccagcgacaacaccgaagcgctttcgcgcgcccgcatccagtacggcaccagc
ctgttctacccggcgacggtcatgggctcgcacgtctcggccacgcccaaccaccagacc
agcaacatcacgccgatcaaattccgcttcgacatggcctgcgcgggccgtctgggcatg
gagttgcagcccaagcagatgaacgccgaggagaaggccttcgcgcgcaaagccatcgaa
agctacaagggataccgcgacatcgtcatggagggcgacctctaccgcatcggcacgcct
tacgacgatacgggctactacggggtgatgtacgtatcgaaagacaagaaaaaagccgtg
ctgttcacctactgcaccctctaccagagccgcacgctggttccgaaataccggctttac
ggactcgacgcgcagacccgctacaagatcagggagcagaacgtcgataagaaacggttc
tggttcgacggcggcaccttcaccggcgaatacctcaaccatgcgggcatcaaccccaat
ctgaacaaaatttacgacagcgccgtattcgtgctcgaagccgaatag

DBGET integrated database retrieval system