KEGG   Alistipes finegoldii: Alfi_1589Help
Entry
Alfi_1589         CDS       T02133                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
afd  Alistipes finegoldii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1785293..1786294)
Genome map
AA seq 333 aa AA seqDB search
MKNYKLLSLIALTAAFSCSPNNEDGQSGNTPVEKYGALKVSGIQLCAQNGKALQLRGMST
HGLQWFGKCQTEEAYRSLAEEWQCDVVRLALYAEENGYNTDPLKFRNKIETLVGYCEKYG
MYCIIDWHVLHPGDPNDPKYDTADDFFAWASKKFAGKPHVLYEICNEPNGDEVTWAVVKR
YAERVIPIIRANSPNAVVICGTPKWSADFTDVVKDPLTYKNILYTYHFYAASHYNYDNLQ
NYLDRLPVFVTEWGTCEYNGSGKYDLDSSQRWIQIMDGDNPGKQRVSWATWNFSDGEGTA
DNLVPGSCAACRFTNVKQPYGQFIRDRIREKRP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactacaaactgctgtcactgatagcgttgacagccgcattctcctgctccccg
aacaatgaagacgggcagtcgggcaacacccccgtcgaaaaatacggcgccctgaaagtc
tccggcatccaattatgcgcccaaaacggcaaagcgttacaactccggggcatgagtacg
cacggacttcaatggttcggcaaatgccagaccgaggaggcttaccggtcgctggccgaa
gagtggcagtgcgacgtcgtccggctcgcgctctacgccgaggagaacggctacaacacc
gatccgctcaagttccgcaacaaaatcgagacgctggtcggttactgcgaaaaatacggc
atgtactgcatcatcgactggcacgtactccatccgggcgatccgaacgatcccaaatac
gacactgcggacgatttcttcgcatgggcgtccaaaaaattcgccggcaaaccccatgtg
ctgtatgaaatctgcaacgaacccaacggcgacgaggtgacgtgggccgtggtcaaacgc
tacgcagaacgggtcattccgatcatccgggccaactctccgaatgccgtggtgatctgc
ggcacgcccaagtggagcgcagacttcaccgacgtggtaaaagacccgctcacgtacaaa
aacatcctctacacctaccacttttacgccgcttcgcactacaactacgacaacctgcaa
aactacctcgaccgtctgcccgtattcgtgaccgaatggggcacctgcgagtacaacggt
tcgggaaaatacgatctggactcctcgcagcgatggatacaaatcatggacggcgacaat
ccgggcaagcagagagtcagctgggcgacatggaacttctcggacggcgaaggcacggcg
gacaatctcgttccgggcagctgcgcggcatgccggttcaccaacgtcaaacagccctac
ggccagtttatccgggaccggatccgggaaaaaaggccctaa

DBGET integrated database retrieval system