KEGG   Alistipes finegoldii: Alfi_1589Help
Entry
Alfi_1589         CDS       T02133                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
afd  Alistipes finegoldii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Alfi_1589
Enzymes [BR:afd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Alfi_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1785293..1786294)
Genome map
AA seq 333 aa AA seqDB search
MKNYKLLSLIALTAAFSCSPNNEDGQSGNTPVEKYGALKVSGIQLCAQNGKALQLRGMST
HGLQWFGKCQTEEAYRSLAEEWQCDVVRLALYAEENGYNTDPLKFRNKIETLVGYCEKYG
MYCIIDWHVLHPGDPNDPKYDTADDFFAWASKKFAGKPHVLYEICNEPNGDEVTWAVVKR
YAERVIPIIRANSPNAVVICGTPKWSADFTDVVKDPLTYKNILYTYHFYAASHYNYDNLQ
NYLDRLPVFVTEWGTCEYNGSGKYDLDSSQRWIQIMDGDNPGKQRVSWATWNFSDGEGTA
DNLVPGSCAACRFTNVKQPYGQFIRDRIREKRP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactacaaactgctgtcactgatagcgttgacagccgcattctcctgctccccg
aacaatgaagacgggcagtcgggcaacacccccgtcgaaaaatacggcgccctgaaagtc
tccggcatccaattatgcgcccaaaacggcaaagcgttacaactccggggcatgagtacg
cacggacttcaatggttcggcaaatgccagaccgaggaggcttaccggtcgctggccgaa
gagtggcagtgcgacgtcgtccggctcgcgctctacgccgaggagaacggctacaacacc
gatccgctcaagttccgcaacaaaatcgagacgctggtcggttactgcgaaaaatacggc
atgtactgcatcatcgactggcacgtactccatccgggcgatccgaacgatcccaaatac
gacactgcggacgatttcttcgcatgggcgtccaaaaaattcgccggcaaaccccatgtg
ctgtatgaaatctgcaacgaacccaacggcgacgaggtgacgtgggccgtggtcaaacgc
tacgcagaacgggtcattccgatcatccgggccaactctccgaatgccgtggtgatctgc
ggcacgcccaagtggagcgcagacttcaccgacgtggtaaaagacccgctcacgtacaaa
aacatcctctacacctaccacttttacgccgcttcgcactacaactacgacaacctgcaa
aactacctcgaccgtctgcccgtattcgtgaccgaatggggcacctgcgagtacaacggt
tcgggaaaatacgatctggactcctcgcagcgatggatacaaatcatggacggcgacaat
ccgggcaagcagagagtcagctgggcgacatggaacttctcggacggcgaaggcacggcg
gacaatctcgttccgggcagctgcgcggcatgccggttcaccaacgtcaaacagccctac
ggccagtttatccgggaccggatccgggaaaaaaggccctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system