KEGG   Alistipes finegoldii: Alfi_1746Help
Entry
Alfi_1746         CDS       T02133                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afd  Alistipes finegoldii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alfi_1746
   01230 Biosynthesis of amino acids
    Alfi_1746
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alfi_1746
   00051 Fructose and mannose metabolism
    Alfi_1746
   00562 Inositol phosphate metabolism
    Alfi_1746
Enzymes [BR:afd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Alfi_1746
Exosome [BR:afd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Alfi_1746
  Exosomal proteins of bladder cancer cells
   Alfi_1746
  Exosomal proteins of melanoma cells
   Alfi_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1956677..1957435)
Genome map
AA seq 252 aa AA seqDB search
MRKKIVAGNWKMNTLPAEGVELAKNIVAGRGEVCSCVNFIVCPPFTHLSTVAEALKGSDV
ALGAQNCAAEAKGAYTGEIAASMIAALGCKYVILGHSERRQYYGETSETLNKKMAQAYAN
GLTPIYCVGENLEEREAGKHFDVVKAQIEEVVYNLTAEQYKELVIAYEPVWAIGTGKTAT
AEQAQEIHAYIRKVLAEKFGAAAEETAILYGGSCKPSNAAEIFAKEDVDGGLIGGAALKA
EDFLGIGKGFAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaaaattgttgccggcaactggaagatgaacacgcttcccgccgaaggtgta
gaactggccaagaacatcgtcgcaggccgcggcgaagtatgctcgtgcgttaatttcatc
gtatgccctccgtttacgcacctctcgacggttgccgaagcgctcaagggttcggacgtc
gcactcggcgcgcagaactgcgcagccgaagccaaaggcgcctacacgggcgagatcgcc
gcttcgatgatcgcggcgctgggctgcaagtacgtgatcctcggccactcggagcgccgc
cagtactacggcgagacttccgagacgctcaacaagaagatggcgcaggcttacgcaaac
ggcctgacgccgatctactgcgtgggcgagaacctcgaagagcgtgaagccggcaagcac
ttcgacgtggtgaaggcgcagatcgaagaggtcgtctacaacctcaccgccgagcagtac
aaggagctcgtgatcgcatacgaacccgtttgggccatcggcacgggcaagaccgcaacg
gccgagcaggcgcaggagatccacgcctacatccgcaaggtgctggccgagaagttcggc
gcagcagccgaagagacggcgatcctgtacggcggttcgtgcaagccctcgaacgcggcg
gaaatcttcgcaaaggaggacgtggacggcggtctgatcggcggcgcagccctcaaggcg
gaggacttcctcggcatcggcaaaggctttgcgaaataa

DBGET integrated database retrieval system