KEGG   Alistipes finegoldii: Alfi_2027Help
Entry
Alfi_2027         CDS       T02133                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
afd  Alistipes finegoldii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Alfi_2027
Enzymes [BR:afd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Alfi_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2280815..2281855
Genome map
AA seq 346 aa AA seqDB search
MEQKTFDPDGVGVDNGTYFGLPFEPETAELVIVSAPWDVTVSYGAGTAYAPDAIIEASTQ
LDFHEPLAPGAWRRGIATADVDYSLLDESQRLRGDAAKVIDLLEGGGSPEDDYVVRKICR
VNEGCAAMNANIGAQAARWLDAGKLVGLVGGDHSTPYGLIRALGERHAEFGILHIDAHCD
LRDAYEGFEFSHASIMFNVLRDVPAVTKIAQVAVRDFSEREAALAASSGRVVLFDDLSLA
AAGFRGETWDAQCLRIVETLPQEVYVSFDIDGLSYENCPHTGTPVAGGLGFNQAVWLLDT
LVRSGRRIVGFDVVEVTPAREERIDAITGARVLWKLCNLTLKSNVR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaaaacgttcgatcccgacggggtcggtgtggataacgggacctatttcggg
ctgcctttcgaaccggagacggccgagctggtgatcgtctcggcgccttgggacgtgacg
gtatcctacggggcggggacggcttacgctcccgatgccattatcgaggcctcgacgcag
ctcgatttccacgaaccgctggctcccggcgcatggcgccgcggcatcgccacggccgac
gtggactattcgctgctggacgaatcgcagcgcctgcgcggcgatgcggcgaaggtgatc
gacctcctcgaagggggcggcagtcctgaggacgactatgtggtgcgcaaaatctgccgc
gtgaacgaagggtgtgcggccatgaacgccaatatcggggcgcaggccgcgcgctggctc
gatgcgggaaaactcgtcgggctggtcggcggcgaccattcgacgccttacggcctgatc
cgcgcgctcggcgagcggcatgcggagttcggaatcctgcatatcgacgcccactgcgac
ctgcgggacgcctacgaggggttcgagttttcgcacgcttcgatcatgttcaacgtgctg
cgcgacgtgcctgcggtgacgaagatcgcccaagtcgccgtgcgcgacttcagcgagcgg
gaggcggcgctggccgcgtcgtcgggccgtgtcgtcctgttcgacgatctgtcgctggcg
gccgccgggtttcgcggcgaaacgtgggatgcgcagtgtctgcgtatcgtcgaaacgctt
ccgcaggaggtctacgtgagtttcgacatcgacggactctcctacgagaactgtccccac
acggggactcccgtcgcgggcggactgggtttcaaccaagccgtctggctgctggacacc
ctcgtgcgttcgggccgccgcatcgtcgggttcgacgtggtggaggtcactccggcccgc
gaggagcggatcgacgccataacgggcgcacgggtattgtggaagttgtgtaatttaact
ttaaaatcaaacgttcgataa

DBGET integrated database retrieval system