KEGG   Alistipes finegoldii: Alfi_2098Help
Entry
Alfi_2098         CDS       T02133                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
afd  Alistipes finegoldii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Alfi_2098
   00670 One carbon pool by folate
    Alfi_2098
Enzymes [BR:afd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Alfi_2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2369709..2370194
Genome map
AA seq 161 aa AA seqDB search
MVSIIVAVAENGVIGDKNALLWHISEDLKYFKSVTSGHPVVMGRKTYESLGRPLPNRTNV
VVTRQEMEIPGCRVAHSLEEAVALFPAEEEVFVIGGAQIYAQALPLAGRFYLTRVFHAYE
GDTHFPAWNDAEWRLVSSESFASGANYPYPFAFETYERRRN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcatcatcgtagccgtcgccgaaaacggcgtgatcggcgataagaacgccttg
ttgtggcatatttccgaagacctgaaatacttcaagtccgttacgtcgggccatcccgtc
gtcatggggcgcaagacctacgagtcgctcggacggccgctgcccaaccggaccaatgtg
gtcgtcacgcggcaggagatggagattccgggatgcagggtggcccattcgctcgaagag
gcggtggcgctgttcccggccgaagaggaggtcttcgtcatcggcggcgcgcagatttat
gcgcaggcccttccgctggccggccgcttctacctgacgcgggttttccatgcctacgag
ggcgatacgcattttcccgcatggaacgacgccgagtggcggctcgtgtcgtccgagtcg
ttcgcttcgggcgcgaattatccctatccctttgcgttcgagacctacgaacggcggcga
aattag

DBGET integrated database retrieval system