KEGG   Alistipes finegoldii: Alfi_2224Help
Entry
Alfi_2224         CDS       T02133                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
afd  Alistipes finegoldii
Pathway
afd00010  Glycolysis / Gluconeogenesis
afd00030  Pentose phosphate pathway
afd00051  Fructose and mannose metabolism
afd00052  Galactose metabolism
afd00680  Methane metabolism
afd01100  Metabolic pathways
afd01110  Biosynthesis of secondary metabolites
afd01120  Microbial metabolism in diverse environments
afd01130  Biosynthesis of antibiotics
afd01200  Carbon metabolism
afd01230  Biosynthesis of amino acids
afd03018  RNA degradation
Module
afd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alfi_2224
   00030 Pentose phosphate pathway
    Alfi_2224
   00051 Fructose and mannose metabolism
    Alfi_2224
   00052 Galactose metabolism
    Alfi_2224
  Energy metabolism
   00680 Methane metabolism
    Alfi_2224
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Alfi_2224
Enzymes [BR:afd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Alfi_2224
Protein phosphatases and associated proteins [BR:afd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Alfi_2224
Messenger RNA biogenesis [BR:afd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Alfi_2224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_4 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFL78507
UniProt: I3YND9
Position
complement(2497810..2498790)
Genome map
AA seq 326 aa AA seqDB search
MAGIKCIGILTSGGDAPGMNAAIRAVTRSAIYNGFAVKGIMRGYKGLVFNEIVSFKSQSV
SNIIQLGGTILKTARSQEFTTTEGRKAAYDNMVAAGIDALVVIGGDGSLTGAGIFAEEYN
VPIVGLPGTIDNDLGGTDSTIGYDTALNTIVEAVDKLRDTASSHERLFFVEVMGHTAGYL
AMNSAIATGSEAAIIPEMETEVDQLAELINHGFRKSKNSAIVIVAENPKTGGATALAERV
KKEFPQYDARVTILGHIQRGGSPTAVDRILASRMGEAAIEALLDGQRNVMIGTMNGKIVY
VPFAKAVKHDKGIDRKDLELVKILSI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctggaatcaaatgtatcggtattctgacttcgggcggcgacgctccgggaatgaac
gccgccatacgcgcggtaacccgcagcgcaatctataacggcttcgccgtcaagggcatc
atgcgcggatacaaaggtctcgtattcaacgagatcgtgtcgttcaaatcccaaagcgta
agcaacatcatccaattgggcggtacgatcctcaagacggcccgcagtcaggaattcacc
acgaccgaaggccgcaaggcggcatacgacaacatggtggcggccggcatcgacgcgctg
gtggtcatcggcggcgacggttcgctcacgggcgccggcatcttcgccgaggaatacaac
gtgccgatcgtgggacttcccggcaccatcgacaacgatctgggcggcaccgactcgacg
atcggctacgacacggcgctcaatacgatcgtcgaagcggtcgataaactccgcgacacg
gcgtcgagccacgagcggctcttcttcgtcgaggtgatgggccacacggcgggttatctg
gcgatgaacagcgccatcgccacgggttccgaagcggcgatcatacccgaaatggaaacc
gaagtggaccagctggccgaactcatcaaccacggcttccgcaagagcaagaactcggcg
atcgtcatcgtggccgagaacccgaagacgggcggcgccacggcgctggccgaacgtgtc
aagaaggagttcccgcagtacgacgcgcgcgtcacgattctgggccatatccagcgcggc
ggatcgccgacggccgtggaccgcatcctcgcctcgcgcatgggcgaagccgccatcgaa
gcgcttctcgacggacagcgcaacgtgatgatcggcacgatgaacggcaagattgtctac
gtcccgttcgccaaagccgtgaagcacgacaagggcatcgaccgcaaagacctcgaactg
gtcaagatactctccatataa

DBGET integrated database retrieval system