KEGG   Alistipes finegoldii: Alfi_2224Help
Entry
Alfi_2224         CDS       T02133                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
afd  Alistipes finegoldii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alfi_2224
   01230 Biosynthesis of amino acids
    Alfi_2224
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alfi_2224
   00030 Pentose phosphate pathway
    Alfi_2224
   00051 Fructose and mannose metabolism
    Alfi_2224
   00052 Galactose metabolism
    Alfi_2224
  Energy metabolism
   00680 Methane metabolism
    Alfi_2224
Enzymes [BR:afd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Alfi_2224
Protein phosphatases and associated proteins [BR:afd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Alfi_2224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2497810..2498790)
Genome map
AA seq 326 aa AA seqDB search
MAGIKCIGILTSGGDAPGMNAAIRAVTRSAIYNGFAVKGIMRGYKGLVFNEIVSFKSQSV
SNIIQLGGTILKTARSQEFTTTEGRKAAYDNMVAAGIDALVVIGGDGSLTGAGIFAEEYN
VPIVGLPGTIDNDLGGTDSTIGYDTALNTIVEAVDKLRDTASSHERLFFVEVMGHTAGYL
AMNSAIATGSEAAIIPEMETEVDQLAELINHGFRKSKNSAIVIVAENPKTGGATALAERV
KKEFPQYDARVTILGHIQRGGSPTAVDRILASRMGEAAIEALLDGQRNVMIGTMNGKIVY
VPFAKAVKHDKGIDRKDLELVKILSI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctggaatcaaatgtatcggtattctgacttcgggcggcgacgctccgggaatgaac
gccgccatacgcgcggtaacccgcagcgcaatctataacggcttcgccgtcaagggcatc
atgcgcggatacaaaggtctcgtattcaacgagatcgtgtcgttcaaatcccaaagcgta
agcaacatcatccaattgggcggtacgatcctcaagacggcccgcagtcaggaattcacc
acgaccgaaggccgcaaggcggcatacgacaacatggtggcggccggcatcgacgcgctg
gtggtcatcggcggcgacggttcgctcacgggcgccggcatcttcgccgaggaatacaac
gtgccgatcgtgggacttcccggcaccatcgacaacgatctgggcggcaccgactcgacg
atcggctacgacacggcgctcaatacgatcgtcgaagcggtcgataaactccgcgacacg
gcgtcgagccacgagcggctcttcttcgtcgaggtgatgggccacacggcgggttatctg
gcgatgaacagcgccatcgccacgggttccgaagcggcgatcatacccgaaatggaaacc
gaagtggaccagctggccgaactcatcaaccacggcttccgcaagagcaagaactcggcg
atcgtcatcgtggccgagaacccgaagacgggcggcgccacggcgctggccgaacgtgtc
aagaaggagttcccgcagtacgacgcgcgcgtcacgattctgggccatatccagcgcggc
ggatcgccgacggccgtggaccgcatcctcgcctcgcgcatgggcgaagccgccatcgaa
gcgcttctcgacggacagcgcaacgtgatgatcggcacgatgaacggcaagattgtctac
gtcccgttcgccaaagccgtgaagcacgacaagggcatcgaccgcaaagacctcgaactg
gtcaagatactctccatataa

DBGET integrated database retrieval system