KEGG   Alistipes finegoldii: Alfi_2315Help
Entry
Alfi_2315         CDS       T02133                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
afd  Alistipes finegoldii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Alfi_2315
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Alfi_2315
Enzymes [BR:afd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Alfi_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2591723..2592808
Genome map
AA seq 361 aa AA seqDB search
MRHLIDPTDLTVAETEQIVALAEDIIANRAKYSEACKGRKLATLFYEPSTRTRLSFTSAM
MELGGSVIGFSDANSSSVSKGETVADTVRVIRCFADIIAMRHFKEGAPLVASQYAGIPVI
NAGDGSHSHPTQTLTDLLTIKREKGRFDNMTIGFCGDLKFGRTVHSLIKALSRYSGIKVI
LIAPQELRLPDYMLAEMSENSKLEFREVETMEEVMPELDILYMTRVQKERFLDEEEFDRV
KNSFVLDPGKLETAKEDMIILHPLPRVNEITRAVDNDPRAAYFRQVENGKFVRMALILTL
LRWADENKPFEKTPVFSEDYVVNEMECSNRRCISATEDVDRLFHRLPDGSCRCAYCEAKA
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagacacctgattgacccgaccgacctgacggtggccgaaaccgaacaaatcgtggcg
ctggccgaagatatcatcgccaaccgcgccaaatacagcgaagcgtgcaaggggcgcaag
ctggcgacgctcttttacgagccttcgacccgcacccgcctgagtttcacctccgccatg
atggagctggggggcagcgtcatcggcttttcggacgccaattcgtcgtccgtgtcgaaa
ggcgaaaccgtggcggacaccgtacgcgtgatccgctgtttcgcggacattatcgccatg
cgccacttcaaggagggcgcgccgctcgtagcttcgcagtacgccggaattccggtcatc
aatgcgggcgacggcagccacagccacccgacgcagacccttacggaccttctgacgatc
aagcgcgagaaggggcgtttcgacaacatgacgatcggcttctgcggcgacctgaaattc
ggccgcacggtccattcgctcatcaaggcgttgtcgcgctattcggggatcaaggtgatc
ctgatcgccccgcaggagctgcgtcttccggactacatgctggccgagatgagcgagaat
tcgaaactcgaattccgcgaagtcgagaccatggaggaggtgatgcccgaactggacata
ctctacatgacgcgtgtgcagaaggagcgtttcctcgacgaggaggagttcgaccgcgtg
aagaacagcttcgtgctcgatcccggaaagctcgaaaccgccaaggaggatatgattatc
ctgcacccgctgccgcgcgtgaacgaaatcacgcgcgccgtggacaacgatccccgcgca
gcctatttccgacaggtcgagaacggcaagttcgtacgcatggcgctgatccttacgctg
ctgcgctgggccgacgaaaacaagcccttcgagaagactcccgttttcagcgaagactac
gtcgtcaatgagatggagtgctccaaccggcgctgtatctcggcgaccgaagatgtcgac
cggcttttccaccgcctgcccgacggctcgtgccgctgcgcctactgcgaggccaaggcg
aagtga

DBGET integrated database retrieval system