KEGG   Alistipes finegoldii: Alfi_2354Help
Entry
Alfi_2354         CDS       T02133                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
afd  Alistipes finegoldii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2643942..2646545)
Genome map
AA seq 867 aa AA seqDB search
MTLLFSIEYRTRWGEQLVLRLGRRRIALQYADSGVWTCAVERYAPAAQPAEYRYEVEREG
VCIRREWRPHILRIPATPAPRTLRIRDRWIDMPADTPFYSSAFTRGIFGRGESGPQQKNG
GNITLRVVLPTLRPDEVLAVAGSGRELEGWQRIVPMDDSRFPEWDLRLDAPQRFEYKFLI
ADRRTLTPIMWEEGPNRAWNDLPGEGEHIVEAAAYLRFPERRWRGAGTAIPVFSLRSEAG
FGVGEFHDLKLLIDWAAATGQRVLQLLPINDTTMNGTWEDSYPYNANSIFALHPQFIRLT
AAGVEEDDEYRSLRDRLNALPEVDYQQVNTHKLRLLRSAFEREGRRTATRRDYREFMQAN
SRWLLPYAAYRTLRDEFGTADFSRWGDYARYDKKAVEAYCRRNSREIAFHCFVQYHLHTQ
LSEVCAYARSRGVVLKGDLPIGVSRTSADAWIHPRLFHMDSQAGAPPDAFSASGQNWGFP
TYDWEHMAQDGYAWWQARMAKMAEYFDAFRIDHILGFFRIWEIPVHAVHGLLGYFNPALP
YSADELRGMGFDTAGGRFTVPAPDDRMLGELFGELADEVRTTCMKEGRLLPAYATQRKVA
ERFPGDDPRRSRLREGLMTLLDDVLFIEDPRRKGFFHPRIAAQSTYMYRTLDPQRRDTFD
RLHDDFFYRRHNRFWQESALRKLPVLLSATRMLACGEDLGMIPDSVPETMRALQILSLEI
QRMPKSLGEVFADPARYPYFSVCTTSTHDMNPLRAWWEENRELSERFYREVLGMEGDAPR
TCEPWICRRIVDMHLRSPAMLAILPLQDWLATDAALRSPHADRERINIPAAPRYYWRYRM
HLTLEELLRQEPFNATLREMIIAGGRR
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgacactcctgttcagcatcgaataccgcacccgctggggcgaacagctcgtactccgc
ctcggcaggcggcgcatcgccctgcaatacgccgacagcggcgtctggacctgcgccgta
gagcgatacgcccctgcggcgcaaccggcagaataccgttacgaagtcgagcgcgagggc
gtgtgcatccgccgcgaatggcgtccgcacatcctgcgcatccccgccacacctgcgccc
cgcacgctccgcatccgcgaccgctggatcgacatgcccgccgatacgcccttctactcc
tcggccttcacgcggggcatattcggccgcggcgaaagcgggccgcagcagaaaaacggc
ggcaacatcaccctgcgcgtcgtcctgccgaccctgcgccccgacgaagtgctggccgtc
gcaggcagcggcagggagctggaggggtggcagcggatcgttccgatggacgacagccgg
tttccggagtgggatctccggctcgacgcgccgcagagattcgaatacaagttcctgatc
gccgaccgcaggaccctgaccccgatcatgtgggaggaaggtcccaaccgcgcatggaac
gacctgcccggcgaaggcgaacacatcgtcgaagccgcggcgtacctccgcttccccgaa
cgcaggtggcgcggagccgggacggcgattccggtcttttcgctccgctcggaagccgga
ttcggcgtcggcgaattccacgacctgaaactgctgatcgactgggccgccgcaacgggc
cagcgggtactccagctgctgccgatcaacgacaccacgatgaacggcacgtgggaagac
tcctacccctacaacgccaattcgatcttcgccctgcacccgcagttcatccggctgacc
gccgccggcgtcgaagaggacgacgaataccgcagcctgcgcgaccggctgaacgccctg
cccgaagtcgattaccaacaggtcaatacgcataaactgcgtctgctgcgcagcgcgttc
gagcgagaggggcgtcgcaccgccacccgccgcgactaccgggaattcatgcaggccaac
agccgttggctcctaccgtatgccgcctaccgcaccctgcgcgacgagttcggcaccgcc
gatttctcccgctggggcgattacgcccgctacgacaaaaaggccgtcgaagcctactgc
cgccgcaacagccgcgaaatcgcgtttcactgcttcgtgcagtaccacctgcacacgcaa
ctgtccgaggtctgcgcctacgcccgcagccggggcgtcgtcctcaagggcgacctgccg
atcggcgtcagccggacgagcgccgacgcatggattcatccgcggcttttccacatggat
tcgcaggccggagcaccgcccgacgccttttccgcatcgggccagaactggggcttcccg
acctacgactgggagcacatggcgcaggacggctatgcgtggtggcaggcccgcatggcg
aagatggccgaatatttcgacgctttccgcatcgaccatatcctcggcttcttccgcatc
tgggagattcccgtacatgccgttcacggcctgctgggctatttcaatcccgccctgccc
tactccgccgacgaactgcgcggcatgggcttcgatacggccgggggacgcttcaccgtt
cccgcgcccgacgaccggatgctcggcgaactgttcggcgagctggccgacgaagtgcgc
acgacctgcatgaaggagggccggctgctgcccgcctatgcgacgcaacgcaaggtcgcc
gagcgctttcccggcgacgatccgcgccgaagccgcctgcgcgaagggctgatgacgctg
ctcgacgacgtgctgttcatcgaggacccgcgccgcaaaggttttttccatccccgcatc
gcggcccaatcgacctatatgtaccgcaccctcgacccgcagcggcgcgacactttcgac
cggcttcacgacgacttcttttaccgccgccacaaccggttctggcaggagtcggccctg
cgcaaactccccgtgctcctctcggcgacgcggatgctggcctgcggcgaggacctcggc
atgattcccgacagcgttcccgaaacgatgcgcgcactgcaaatcctttcgctcgaaatc
cagcggatgcccaaatcgctgggcgaggtgttcgccgacccggcgcgctacccctatttc
tcggtctgcaccacctcgacccacgacatgaatcccctgcgggcatggtgggaggagaac
cgcgaactctcggaacgtttctaccgcgaagtgctgggcatggagggcgacgctccccgc
acctgcgaaccgtggatctgccgccgcatcgtcgacatgcacctacgctccccggccatg
ctcgccatacttccgctgcaggactggctcgcgaccgacgcggccctgcgcagtccgcat
gcggacagggagcgcatcaacatcccggccgcgccccgctattactggcgctaccgcatg
cacctcacgctggaggagctgctccggcaggagccgttcaacgccacgctccgcgaaatg
ataatcgccggcggccgccgttaa

DBGET integrated database retrieval system