KEGG   Alistipes finegoldii: Alfi_2664Help
Entry
Alfi_2664         CDS       T02133                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
afd  Alistipes finegoldii
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:afd00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:afd02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3005314..3007245
Genome map
AA seq 643 aa AA seqDB search
MKRILKSWLLAAALCFCVTAAAERPVLIHSHNDYCRRAPFWQAYAQGVYSIEADVFLHDG
KLLVGHDVEDLSPDMTFESLYVEPIVTLFKRNGGRAWKDSDEQLQLMVELKSATEPTLQA
VTALLGRYPEVFDPTVNPEAVRIAVTGRVPAPADFGKYPAYVRFDGNWEVDYTPAQLERI
ALVSADFKDYSQWNGKGSIIPVERVKLEKIIDRAHGWGKPVRFWGAPEGTTVYYTFYDMG
IDYINTDRPEVCAGFFDDFGNKNFQIGQRRTSVGGVTGTKRLDKTTRDFRGFQNDKLQLT
EGIDVYTPTYRNDGGRGKVKNVIYLIGDGMGLSQIVAAFYANKGLSTLQMKYMGLQQNNA
LDAFTTDSAAGGSALATGERHDNRHISMSSEGEPYPSLSDFFHDKGMPVGVLTLGNVADA
TPTAFYGHSVERDNADELTRCLMDGRVDLLCGSGIREFTRRSDGVELISELKKQYDFVRS
VDEIKARKGKVICIDETMDDAAEQANLTLLADATRASIAKLQEQGGKGFFLMVEGAKIDY
AGHSRCLPGSIIEMLSFDLAVAEALKFADRNGETLVVVTADHETGGLVLVDGDERTGRVM
GVYVSDDHTPAMLPVFAYGPGADKFCGTYMNTEIARRIKSLIK
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggatactgaaaagctggctgctggctgcggcattgtgcttctgcgtaacggct
gcggccgaacggcccgtgctgatccattcgcacaacgattattgccgccgcgctcctttc
tggcaggcgtacgctcagggagtctattcgatcgaagccgacgtgtttctgcacgacggt
aaactgctggtcggacacgatgtcgaggacctttcgcccgatatgactttcgagtcgctc
tatgtcgagccgatcgtgacgctttttaagcgtaacggcggccgtgcatggaaagattcg
gacgagcagctgcaactgatggtcgaactcaaatcggcgaccgaaccgacgctgcaggcc
gttacggcgctgctgggccgttatcccgaagtcttcgacccgaccgtgaatcccgaagcc
gtgcgtatcgccgttacgggacgggttcctgcgcctgcggatttcggcaaatatcccgcc
tatgtccgtttcgacggcaactgggaggtcgattacactccggcccagctggaacgtatc
gcccttgtaagcgccgatttcaaggattattcgcagtggaacggcaaaggctcgatcatt
cccgtcgagcgcgtgaagctggaaaagatcatcgaccgcgcccacggctggggcaagccc
gtgcgtttctggggcgctcccgaaggaacgacggtctattatacgttctacgacatgggg
atcgactacatcaacaccgaccgtccggaggtctgcgccggattcttcgacgatttcggc
aacaagaatttccagatcggccagcgccgtacgtccgtcggtggcgtgaccggcacgaag
cgtctggacaagaccacgcgcgatttcaggggatttcagaacgataaactgcagctcacc
gagggtatcgacgtttacacgccgacctatcgaaacgacggcggcagggggaaagtcaaa
aacgtgatctacctgatcggcgacggcatgggcctttcgcagatcgtggccgcgttttat
gccaacaaggggctttcgacgctgcagatgaagtatatgggcctgcagcagaataatgcg
ctggatgccttcacgaccgactcggccgcgggcggcagtgcgctggcgacgggcgaacgt
cacgataaccgccatatttcgatgagttccgaaggcgagccgtatccttcgctgagcgac
tttttccatgacaaggggatgccggtgggcgtgctgacgctcggcaatgtcgccgatgcc
acgccgacggccttctacggacattcggtcgaacgcgacaacgccgacgagctgacccgc
tgcctgatggacggccgcgtggacctgctctgcggcagcggcatccgcgaattcacccgc
cgcagcgacggcgtggagctgatctccgagctgaaaaaacagtatgacttcgtgcgttcg
gtcgacgagatcaaggcccggaaaggcaaggtgatctgcattgacgagacgatggacgat
gccgccgagcaggccaacctcaccttgctggccgacgccacgagggcttcgatcgccaaa
ctgcaggagcagggcggcaaaggcttcttcctgatggtcgagggcgccaagatcgactat
gccggccattcgcgctgcctgcccggctcaattatcgaaatgctgagcttcgacctcgcc
gtggccgaagcgctgaaattcgccgaccgaaacggcgagacgctcgtcgtggtcacggcc
gaccacgagacgggcggactggtgctggtggacggcgacgagcggacgggccgcgtgatg
ggcgtctatgtctccgacgaccatacccccgcgatgcttcccgtattcgcatacggtccc
ggagccgacaagttctgcggtacgtatatgaatacggagatcgcccgcaggatcaaatcg
ctgataaaataa

DBGET integrated database retrieval system