KEGG   Alistipes finegoldii: Alfi_2667Help
Entry
Alfi_2667         CDS       T02133                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
afd  Alistipes finegoldii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alfi_2667
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alfi_2667
   00052 Galactose metabolism
    Alfi_2667
   00500 Starch and sucrose metabolism
    Alfi_2667
   00520 Amino sugar and nucleotide sugar metabolism
    Alfi_2667
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Alfi_2667
   00524 Butirosin and neomycin biosynthesis
    Alfi_2667
Enzymes [BR:afd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Alfi_2667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3009901..3010722
Genome map
AA seq 273 aa AA seqDB search
MRIGVDLGGTNVRAGLVKDGHIVRLLSEPCKADRPEGEVVDHIASLIGELMRPEVSRIGI
GVPSVVDAARGIVYNVVGIPSWREVYLKDLLEKRFSVPVHVNNDCNCFALGVCRFGEASA
FSDVVCVALGTGVGAGVVIGGKLYCGRDTGAGEIGSIPYLDRDYEYYCSSRFFVGRGTTG
KEAYERAAAGDPEALALWREFGGHVGQLVMLVLYTYDPEAIVFGGSIAHAFGFFREAMYE
QLKRFPYAKTVEGLHICCSNIDHVGLLGASACE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagaataggcgtggatttgggcggcacgaacgtgcgcgccggccttgtgaaagacgga
catatcgtgcggctgctttccgaaccctgcaaagccgaccgtcccgaaggggaggtggtg
gatcatatcgcatcgcttatcggggagcttatgcgacctgaggtttcgcggatcggtatc
ggcgtgccgtcggtggtggacgctgcgcggggaatcgtatataatgtggtgggcatccct
tcgtggcgcgaggtttacctcaaagacctgctcgaaaagcgtttcagcgtgccggtgcat
gtcaacaacgactgcaactgttttgcgctgggcgtctgccgcttcggcgaggcgagcgcg
ttcagcgacgtggtgtgcgtggcgctcggcacgggcgtcggcgcgggagtcgtgatcggc
gggaaactctactgcggccgggacaccggggcgggggagatcggaagcatcccgtatctg
gaccgggattacgaatactattgcagcagccgcttcttcgtgggccgcggcacgacgggc
aaggaggcttacgagcgcgccgcggcgggcgatcccgaagcgttggcgctttggcgcgag
ttcggggggcatgtcggccagctggtgatgctggtgctctatacgtacgaccccgaagcg
atcgtcttcggcggcagcatcgcccatgcgttcggctttttccgtgaagcgatgtacgaa
cagctgaaacggttcccctatgccaagaccgtcgagggactgcatatctgctgttcgaat
atcgaccacgtaggactgctgggagcttcggcctgcgaataa

DBGET integrated database retrieval system