KEGG   Alistipes finegoldii: Alfi_2840Help
Entry
Alfi_2840         CDS       T02133                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
afd  Alistipes finegoldii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:afd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3209917..3210501
Genome map
AA seq 194 aa AA seqDB search
MYEYISGPVAEVAPAYAVIDAGGVGYYLHISLETFSAIEHTETARLYVHYVVREDAQLLY
GFATKTERELFRHLISVSGVGGNTARMILSTYSPRELQGIITSGNAVLLKNVKGLGLKTA
QKIIVELSGKLTGLGDADAALPAAGNGEKLEEALAALVMLGFAKTAAEKALRGILRENPG
ASVEDLVRMGLKSL
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatacatcagcggtccggtggccgaagtcgctcccgcatacgcagttatagat
gccggcggggtaggttattacctccatatctcgcttgaaacgttttcggccatcgagcac
accgagacggcccgtctgtacgtccattacgtcgtgcgcgaggacgcgcagctgctctac
ggtttcgcgaccaaaaccgagcgcgaactcttccgccatctgatcagcgtgtcgggcgtc
ggcggcaataccgcccggatgatcctttcgacctattcgccgcgcgaattgcagggcatc
atcacttcgggcaacgccgtgctgctgaaaaacgtcaaggggctggggctgaaaaccgcc
cagaaaatcatcgtcgagctgagcggcaagctcaccggactgggcgacgccgacgccgct
cttccggctgccggcaacggcgaaaagctcgaagaggcgctcgcggcgctggtcatgctc
ggctttgccaaaactgccgccgagaaggctcttcgcggcattctgcgcgaaaatccgggg
gcttcggtcgaggatttggtgcgaatgggcttaaaaagcctatga

DBGET integrated database retrieval system