KEGG   Alistipes finegoldii: Alfi_2852Help
Entry
Alfi_2852         CDS       T02133                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
afd  Alistipes finegoldii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:afd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3223806..3224645
Genome map
AA seq 279 aa AA seqDB search
MKQHDIDLDLSRPQVMAILNVTPDSFFAGSRMPDATHVERRVKEAAAEGASIIDVGGYSS
RPGADEVPADEEWRRVELGIGAVRRLAPGVLISVDTFRSEVAARAIEKFGPLIINDISAG
ELDPQMPATAARCGVPYVAMHMKGDPRTMQTLTDYKRDITAEVTAYFETKTADLLAAGIK
RENIILDPGFGFAKTTEQNYELLAGLHCLCALGYPVLAGLSRKSMIYRVLDATPAESLAG
TVALGWECLRQGAAILRVHDVQEAVDTVRLFDAYERNRK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcacgacattgatctcgacctctcccggccgcaggtgatggcgatcctgaac
gtcacccccgactcgttcttcgccggcagccgcatgcccgacgcgacgcatgtcgaacgc
cgcgtgaaggaggccgccgccgaaggcgcctcgatcatcgacgtggggggctattcgtcg
cgccccggcgccgacgaagtccctgccgacgaggagtggcggcgcgtggagctgggcatc
ggggccgtgcggcgtctggcgcccggcgtcctgatttcggtcgataccttccgcagcgaa
gtcgccgcccgtgcgatcgaaaaattcggtccgctcatcatcaacgacatctccgccggg
gaactcgacccgcagatgcccgccacggctgcgcgctgcggcgtgccctacgtcgccatg
cacatgaagggcgatccccggaccatgcagaccctcaccgactacaaacgcgacatcacg
gccgaggtcacggcctatttcgaaacgaagaccgccgacctgctcgccgccgggatcaaa
cgcgagaacattatcctcgaccccggcttcggcttcgccaagaccaccgaacagaattac
gagctgcttgcgggcctgcactgtctctgcgcattggggtatcccgtactggcgggcctt
tcgcgcaagtcgatgatctaccgcgtcctcgacgccacgcccgccgaatcgctcgcgggc
accgtcgccctcggctgggagtgcctgcgtcagggggccgcgatcctgcgcgtgcacgat
gtgcaggaggccgtcgatacggtcaggctcttcgacgcatacgaacggaaccgcaaataa

DBGET integrated database retrieval system