KEGG   Alistipes finegoldii: Alfi_2901Help
Entry
Alfi_2901         CDS       T02133                                 

Definition
(GenBank) L-glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
afd  Alistipes finegoldii
Pathway
afd00220  Arginine biosynthesis
afd00250  Alanine, aspartate and glutamate metabolism
afd00471  D-Glutamine and D-glutamate metabolism
afd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Alfi_2901
   00220 Arginine biosynthesis
    Alfi_2901
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Alfi_2901
Enzymes [BR:afd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Alfi_2901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AFL79151
UniProt: I3YQ83
Position
complement(3283287..3284270)
Genome map
AA seq 327 aa AA seqDB search
MIQKIDNATVREAVQQAYERCKNETGGKNADYIPYLANVPSNLFGIAACLPDGEVIAVGD
TDYKFGIESVSKVPTAILAMNQYSAQEMLDKIGADATGLPFNSIMAILLENDHPSTPLVN
AGAISACSMVKPVGDSDGKWKSIVGFIEGLAGSQVEVIDELYKSETATNFNNKSIAWLLK
NYNRIYDDPDMSLDIYTRQCSIGVTAKQLATMAATIANGGVNPVTKQPVFKPELAPKIAS
LMATVGFYEHTGDWLFTTGLPAKTGVGGGIMGVVPGVMGVAAFAPPLDEAGNSVKAQKAL
AYVAGHLNLNIFGTTRCVMAEKEPAKA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaaatagacaacgctacggtccgcgaggccgtacagcaggcatacgagcgc
tgcaagaacgaaacgggcggcaagaacgccgactatatcccctatctggccaacgtgccg
tcgaacctcttcggcatcgcggcctgcctgcccgacggcgaagtgatcgccgtgggagac
accgattacaaattcggcatcgagtcggtatcgaaggtgccgacggcgatactcgccatg
aaccagtacagcgcgcaggagatgctcgacaagatcggcgccgacgcgacgggactgcct
ttcaactcgatcatggcgatcctgctggagaacgaccacccctcgacgccgctggtgaac
gccggtgcgatcagcgcctgctcgatggtgaaacccgtcggcgacagcgacggcaaatgg
aagtcgatcgtcggttttatcgaagggctggccggatcgcaggtcgaagtgatcgacgag
ttgtacaaatcggagacggcgaccaacttcaacaacaagtcgatcgcatggctgctgaag
aattacaaccggatttacgacgatcccgacatgtcgctggacatctacacgcgccagtgt
tcgatcggcgtgacggccaagcaactcgcaacgatggccgcgacgatcgccaacggcggc
gtgaatcccgtgaccaagcagccggtattcaaaccggaactggcgccgaagatcgcatcg
ctgatggcgacggtgggcttctacgagcacacgggcgactggctcttcacgacgggcctg
ccggccaagacgggcgtcggcggcggcatcatgggcgtagttccgggcgtgatgggcgtt
gcggcgttcgctcccccgctggacgaagccggcaactcggtcaaggcgcagaaggcgctg
gcctatgtcgccgggcacctcaacctcaatatcttcggcacgacgcgctgcgtgatggcc
gaaaaggaacccgcaaaggcatag

DBGET integrated database retrieval system