KEGG   Alistipes finegoldii: Alfi_2910Help
Entry
Alfi_2910         CDS       T02133                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
afd  Alistipes finegoldii
Pathway
afd00010  Glycolysis / Gluconeogenesis
afd00030  Pentose phosphate pathway
afd00051  Fructose and mannose metabolism
afd00052  Galactose metabolism
afd00680  Methane metabolism
afd01100  Metabolic pathways
afd01110  Biosynthesis of secondary metabolites
afd01120  Microbial metabolism in diverse environments
afd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alfi_2910
   00030 Pentose phosphate pathway
    Alfi_2910
   00051 Fructose and mannose metabolism
    Alfi_2910
   00052 Galactose metabolism
    Alfi_2910
  Energy metabolism
   00680 Methane metabolism
    Alfi_2910
Enzymes [BR:afd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Alfi_2910
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Alfi_2910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFL79160
UniProt: I3YQ92
Position
complement(3290884..3292119)
Genome map
AA seq 411 aa AA seqDB search
MKEAIAILTGGGPAPGMNTVVGSVAKTFLRKGYRVIGLHEGYTGLFNPSPRTVDIDYPMA
DGIFNQGGSFLQMSRFKPKDSDFENNFNLKFFTDNNIKLLVTVGGDDTASTANRIAKFLE
AKKYPIANIHVPKTIDNDLPLPKGTPTFGYESAKDKGAVIARAVYVDARTSGNWFVLAAM
GRSAGHLAFGIGEACHYPMIVIPEMFDKTEITVEKIVNLVISSIIKRKIMGMDYGAAVIS
EGVFHALSDEEIRKSGIHFTYDEHGHPELGKVSKAHIFNEMIEKKVKELGIKVKSRPVEL
GYEIRCQTPIAYDLTYCSELGIGVHKLFAEGKTGCMVYVDSEGNVSPLYLKDLQDPTTGK
IPPRLVDIKSDKFSSVVETILNAITPADYEAAKQYVPNPEEYDFHKILNWK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcaatcgcaattctgactggcggcggacccgcacccggtatgaataccgtc
gtgggcagcgtcgcaaagaccttcctccgcaaaggttaccgcgtaatcggcctgcacgaa
ggctacacgggactgttcaacccctcgccccgaaccgtggacatcgactaccccatggcc
gacggtatcttcaatcagggaggttcgttcctgcagatgagccgtttcaaacccaaggat
tcggatttcgaaaacaacttcaacctcaagttcttcaccgacaacaacatcaaactgctc
gtgacggtcggcggcgacgacacggcttcgaccgcgaaccgcatcgccaagttcttggag
gccaagaaataccccatcgccaacatccacgtcccgaagaccatcgacaacgacctgccc
ctgccgaaaggcacgccgacgttcggttacgagtcggccaaggacaagggcgccgttatc
gcacgtgccgtctacgtagacgcccgcacgagcggcaactggttcgtactggctgccatg
ggccgcagcgccggccacttggcattcggcatcggcgaggcttgccactacccgatgatc
gtcattcccgaaatgttcgacaagacggaaatcaccgtcgagaagatcgtgaacctcgtg
atttcgtcgatcatcaagcgcaagatcatgggcatggactacggagctgccgttatctcg
gaaggcgtattccacgcgctgagcgacgaggagatccgcaagagcggcatccacttcacc
tatgacgagcacggacaccccgaactgggcaaggtatcgaaggcgcacatcttcaacgag
atgatcgagaagaaggtgaaagagctgggcatcaaggtcaagagccgccccgtggagctg
ggttacgagatccgctgccagaccccgatcgcatacgacctgacgtactgctcggagctg
ggtatcggcgtgcacaagctcttcgccgaaggcaagaccggctgcatggtttacgtggat
tcggaaggcaatgtaagtccgctctacctcaaggacctgcaggatcccacgacgggcaag
attccgccccgtctggtggacatcaagtcggacaagttctcgtcggtggtggagaccatc
ctcaacgccatcacgcccgcggattacgaggctgccaaacagtatgtccccaatccggag
gagtacgatttccacaagatcctcaactggaaataa

DBGET integrated database retrieval system