KEGG   Alistipes finegoldii: Alfi_3176Help
Entry
Alfi_3176         CDS       T02133                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
afd  Alistipes finegoldii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Alfi_3176
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alfi_3176
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alfi_3176
Enzymes [BR:afd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alfi_3176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3601634..3602995
Genome map
AA seq 453 aa AA seqDB search
MKTKKFCLTENQMPAQWYNIVADMPNKPLPPLHPATKQPVTKEQMSAIFAEELIDQEMSA
ERFIDIPEEVQEIYKIWRPTPLVRATGLEKALGTPAKIYFKNESVSPAGSHKPNTAVPQA
YYNYKQGIRRLTTETGAGQWGAAIAFAAKHFGIDLQVYMVKVSYDQKPYRRLMMNTWGAE
CIASPSTLTASGRAALERDPNCSGSLGLAISEAIEVALQHPEDTRYCLGSVLNHVILHQT
VIGQEAVAQMEMADAEPDVVIGCFGGGSNFAGLGFPFLRKNLTEGKKIRIVAVEPSSCPK
LTRGSFQYDFGDVAGFTPLLPMYTLGHDFQPSDIHAGGLRYHGAGSIVSQLLKDGLVEAQ
SLPQTETLAAGILFAKTEGIIPAPESTHAIAAAIREAMQAKEEGTPKTILFNLSGNGVID
LYAYEQYLAGALKDYAPGDAEIAKTVSRLEQLI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaaaaattctgcctgaccgagaatcagatgcccgcgcaatggtacaacatc
gtggccgacatgcccaacaaaccgctgcccccgctgcatcccgcgaccaagcagcccgta
accaaagagcagatgagcgccattttcgccgaagagctgatcgatcaggagatgtccgcg
gagcggttcatcgacattcccgaagaggtgcaggagatttacaaaatatggagacccacg
ccgctcgtgcgggctacggggctggagaaggcgctcggcacgcccgcgaaaatctatttc
aagaacgagagcgtctcgccggccggatcgcacaagcccaacaccgccgtgccgcaggcc
tactacaactacaagcagggcatccgccgcctgaccaccgagacgggcgcggggcagtgg
ggcgcggcgatcgcattcgcggccaagcacttcggcatagacctgcaggtttacatggtc
aaggtcagctacgaccagaaaccctaccggcggctgatgatgaacacttggggcgccgag
tgcatcgcatcgcccagcacgctcacggcatcgggccgtgcggcgcttgaacgcgacccg
aactgttcgggaagcctcggactggccatttcggaggcgatcgaagtggcgctgcaacac
cccgaagatacgcggtactgtctgggaagcgtgctgaaccacgtcatcctgcatcagacc
gtgatcggacaggaagccgtggcgcagatggagatggccgacgccgagccggacgtggtg
atcggatgcttcggcggcggcagcaacttcgcgggactgggattcccgttcctgcgcaag
aacctcacggaaggcaaaaaaatccggatcgtggcggtcgagccgtcgagctgcccgaaa
ctcacgcgcggcagtttccagtacgacttcggcgacgtggcgggattcacgcccctgctg
ccgatgtatacgctggggcacgatttccagccgtcggacatccacgcgggcggactgcgt
taccacggcgcggggtcgatcgtcagccagctgctcaaagacggactcgtcgaagcgcag
tcgctgccgcagaccgagaccctcgccgcaggcattctcttcgccaagaccgagggcatc
atcccggcgccggaatcgacgcacgccatcgccgcggccatccgcgaagccatgcaggcc
aaagaggaggggacgcccaagacgattctgttcaacctctcaggcaacggcgtgatcgac
ctctacgcctacgaacagtatctggcgggagcgctgaaagactatgcgccgggggatgcg
gaaatcgcaaagacggtcagccggctggagcagctgatatga

DBGET integrated database retrieval system