KEGG   Alistipes finegoldii: Alfi_3176Help
Entry
Alfi_3176         CDS       T02133                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
afd  Alistipes finegoldii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Alfi_3176
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alfi_3176
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alfi_3176
Enzymes [BR:afd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alfi_3176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3601634..3602995
Genome map
AA seq 453 aa AA seqDB search
MKTKKFCLTENQMPAQWYNIVADMPNKPLPPLHPATKQPVTKEQMSAIFAEELIDQEMSA
ERFIDIPEEVQEIYKIWRPTPLVRATGLEKALGTPAKIYFKNESVSPAGSHKPNTAVPQA
YYNYKQGIRRLTTETGAGQWGAAIAFAAKHFGIDLQVYMVKVSYDQKPYRRLMMNTWGAE
CIASPSTLTASGRAALERDPNCSGSLGLAISEAIEVALQHPEDTRYCLGSVLNHVILHQT
VIGQEAVAQMEMADAEPDVVIGCFGGGSNFAGLGFPFLRKNLTEGKKIRIVAVEPSSCPK
LTRGSFQYDFGDVAGFTPLLPMYTLGHDFQPSDIHAGGLRYHGAGSIVSQLLKDGLVEAQ
SLPQTETLAAGILFAKTEGIIPAPESTHAIAAAIREAMQAKEEGTPKTILFNLSGNGVID
LYAYEQYLAGALKDYAPGDAEIAKTVSRLEQLI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaaaaattctgcctgaccgagaatcagatgcccgcgcaatggtacaacatc
gtggccgacatgcccaacaaaccgctgcccccgctgcatcccgcgaccaagcagcccgta
accaaagagcagatgagcgccattttcgccgaagagctgatcgatcaggagatgtccgcg
gagcggttcatcgacattcccgaagaggtgcaggagatttacaaaatatggagacccacg
ccgctcgtgcgggctacggggctggagaaggcgctcggcacgcccgcgaaaatctatttc
aagaacgagagcgtctcgccggccggatcgcacaagcccaacaccgccgtgccgcaggcc
tactacaactacaagcagggcatccgccgcctgaccaccgagacgggcgcggggcagtgg
ggcgcggcgatcgcattcgcggccaagcacttcggcatagacctgcaggtttacatggtc
aaggtcagctacgaccagaaaccctaccggcggctgatgatgaacacttggggcgccgag
tgcatcgcatcgcccagcacgctcacggcatcgggccgtgcggcgcttgaacgcgacccg
aactgttcgggaagcctcggactggccatttcggaggcgatcgaagtggcgctgcaacac
cccgaagatacgcggtactgtctgggaagcgtgctgaaccacgtcatcctgcatcagacc
gtgatcggacaggaagccgtggcgcagatggagatggccgacgccgagccggacgtggtg
atcggatgcttcggcggcggcagcaacttcgcgggactgggattcccgttcctgcgcaag
aacctcacggaaggcaaaaaaatccggatcgtggcggtcgagccgtcgagctgcccgaaa
ctcacgcgcggcagtttccagtacgacttcggcgacgtggcgggattcacgcccctgctg
ccgatgtatacgctggggcacgatttccagccgtcggacatccacgcgggcggactgcgt
taccacggcgcggggtcgatcgtcagccagctgctcaaagacggactcgtcgaagcgcag
tcgctgccgcagaccgagaccctcgccgcaggcattctcttcgccaagaccgagggcatc
atcccggcgccggaatcgacgcacgccatcgccgcggccatccgcgaagccatgcaggcc
aaagaggaggggacgcccaagacgattctgttcaacctctcaggcaacggcgtgatcgac
ctctacgcctacgaacagtatctggcgggagcgctgaaagactatgcgccgggggatgcg
gaaatcgcaaagacggtcagccggctggagcagctgatatga

DBGET integrated database retrieval system