KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0062Help
Entry
Lferr_0062        CDS       T00758                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:afe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lferr_0062 (ruvA)
Enzymes [BR:afe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Lferr_0062 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
65264..65845
Genome map
AA seq 193 aa AA seqDB search
MITSLTGTILQRRPPWLWLDVQGVGYELEMPLSGFYQMPAEGAALTVHTHLTIREDAHLL
YGFMTVAERDMFRLLIRVNGIGGKVALACLSGLPAERLSQAVAEGNTAQLTAIPGIGPKT
AERLVVELRDKMGGIAPGPMGRGGAGDPRQEAIAALLTLGYKPAQASQAIAGLADGLGLE
DLIRQSLQNLSRH
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcacctcccttaccggcaccatcctgcagcggcgtccgccctggctctggctcgat
gtgcagggcgtcggctatgaactggagatgcccctgtccggtttttaccagatgcccgcc
gaaggcgcggcgctgaccgtccacacccacctcacgatccgcgaagacgcgcatctgctc
tatggtttcatgaccgtggcggaacgcgacatgtttcggctgctgatccgggtgaacggc
atcggcggcaaggtggcgctggcgtgtctgtccggtttgcccgccgagcggctcagtcag
gccgtggccgagggcaacacggcgcagctcaccgccatccctggaatcggcccgaaaacc
gccgagcggctggtggtggaactgcgcgacaagatgggcggcatcgcgccggggccgatg
gggcgcggcggtgccggtgatccccgtcaggaagccattgcagcgctgctgactttaggt
tataagcctgcgcaggcgagccaggcgatagccggtctggcggacggactgggtctggaa
gacctcatccgtcagtcgctgcagaatttgtcacgtcactga

DBGET integrated database retrieval system