KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0152Help
Entry
Lferr_0152        CDS       T00758                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lferr_0152
Enzymes [BR:afe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Lferr_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
141847..143166
Genome map
AA seq 439 aa AA seqDB search
MKTVAVVGSGASGVASAFALQAAGYQVVMLEATKNLGGRMGDAYLGDRRIDFGGKNIGRN
YPLFRQFAETQLPVHYEFFGINSASVRNGRLYRIDSESRLKTLLNMVDLIGPMNFLRIAR
LAWAVRRDPENAFLGGPYFRRVAQRYDHAPMSTYFGDQCLRHLLRPMTVRMNGAEPDEYY
LGNIGSNIKMILDRYDQIKEGLHTVLDAFFESITVMRETVVDGLLMDGKRVVGLRATQRG
KSVDKFYDGVVVGVPAHEGARMLPEALSPLRDLLNGINYHPVAVAVVQYDRPVFPDHTRA
VVFSDDHIVSNAGAYGAEDRNIVRYTFSGRAFRENISVTTPIEEMLAMAEADLSPFFPDC
KQPRLAFVYRYFQTGLCAYGPYHSQFLDSVDSHLSAVSGLALAGDYIRGGSIEACFRAGY
EAAERLGAVFRPETLRTAL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgttgcggtggtcggatctggcgcgtctggtgttgccagcgcgttcgccttg
caagctgcgggctatcaggtggtcatgttggaagccacaaagaatttgggcgggcgcatg
ggcgatgcttatttgggagaccgccgaatcgacttcggaggaaaaaacataggacggaac
tacccgctatttcgccagttcgcagaaacccaacttccggtccactacgaattcttcgga
ataaattctgctagcgtgcgcaatggtcggctctacagaattgatagtgagagtcggctc
aagacattattaaacatggtggacctcatcgggccaatgaatttccttaggatcgcgcgc
ttagcttgggccgtacgtcgtgatccggagaacgcgtttctgggcgggccgtattttcga
agagtcgcgcaacgatacgatcatgctcctatgtcgacctatttcggcgatcaatgcctg
cgtcacctgctgagaccgatgactgtgcgcatgaacggggcggagccggatgagtattac
cttggtaacattggatcgaacattaagatgatcctcgaccgctacgaccagataaaagag
ggtctgcacaccgtcctggatgcgttcttcgagtcgataacggtcatgcgggaaaccgtg
gtcgacggccttctgatggatggaaaacgggttgtaggcctacgcgcaacacagcgcggg
aagagtgtggataagttctatgacggcgtagtcgtaggtgtaccggcccatgaaggtgcg
cgtatgcttccagaagcgttgtctccacttcgagacctgctcaatggcataaactaccat
cccgttgctgttgcagtagttcagtatgaccggccggtgtttccagatcatacccgcgcc
gttgtgttctctgacgatcatattgtcagtaacgcgggcgcatacggcgccgaagatcgc
aatatcgtccgttatactttcagcgggcgtgctttccgggaaaatatttccgtaacaacc
ccgattgaggagatgttggcgatggccgaagctgacctatcaccgttcttcccagactgc
aagcagccgcgactagcttttgtctaccgctacttccagacaggcctctgcgcctatggc
ccgtatcactcccaatttcttgactcagtagatagccatttgagcgcggtgtccggttta
gccttggcaggcgactatatccgtggcggatctatcgaggcgtgctttcgggcaggctat
gaggcagcggagcgtcttggagcggtgtttcggccagagacattaaggacagcgttgtag

DBGET integrated database retrieval system