KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0153Help
Entry
Lferr_0153        CDS       T00758                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
Enzymes [BR:afe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Lferr_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 NmrA GDP_Man_Dehyd Polysacc_synt_2 KR NAD_binding_4 RmlD_sub_bind adh_short adh_short_C2 DapB_N
Motif
Other DBs
NCBI-ProteinID: ACH82414
JGI: Lferr0153
UniProt: B5EK54
Position
143186..144202
Genome map
AA seq 338 aa AA seqDB search
MDTVLVTGANGHLGYNLTQQLVERGYRVRAGVRDFTSKTKTRDLVTLGAEITHVDITRPE
TLSAAMKDVQGLFHVAAVYETISRNPGRDVKQPTIVGTINTLQAAHAAGVQKVVLTSSAT
TAGNDASLEAPLDESRWNKDAIEPYVQAKTSAERWAWEFATRNHFNLVAILPSAMIGPGF
RRHTPTTRIFEELLRNRVPVVLPLGFSFVDVRDVATAHVLAYENPTAAGRYIASARFCEL
AELFTLVCNVDPTVVIPTRRLPERLLPVVPLLDWIGHRFAGTPRAISCAFVKEYGHREAH
FTSARAERELGWMARDFSVSVRDTLSWIKTELLPAGAA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggatacggtattggttactggggccaacgggcacctaggttacaatcttacgcagcaa
ttagttgaacgtggataccgagtgcgcgcaggcgtgcgcgatttcacctccaaaaccaag
actcgggacctcgtaacccttggtgccgaaattactcacgtggatattacgcgacctgag
acgctttctgccgctatgaaggacgtgcagggcctgtttcatgtggccgctgtgtacgag
acgataagccgcaatcctgggcgagatgtgaagcagcccaccatcgtcgggacgatcaat
acgcttcaagctgcccatgcggctggggtccagaaagttgtcctcacgtcaagcgcaacg
acggcgggcaacgacgcctccctagaggcgcctctcgatgaatcgcggtggaacaaagac
gcgattgagccgtacgtgcaggcgaaaaccagcgccgaacgatgggcgtgggagtttgct
acccgtaaccattttaatcttgtggcaatcctgccttccgctatgattggccctggtttt
cgcaggcacacaccaacaacacgaatatttgaagagcttttgcgcaatcgcgtaccggtt
gttctgccgcttggcttcagttttgtcgatgtccgtgatgtcgcaactgctcatgtactc
gcctacgagaatccaacggcggcaggccgctatattgcttccgcgcgcttttgcgagctt
gctgagctttttacactcgtctgcaatgtggaccccacagtggttatacccacacgcaga
ttgccagagcggttgcttccggttgtcccattactcgactggatagggcaccgtttcgca
ggaacacctcgtgcgatttcctgtgcgttcgtcaaggagtacggccatcgcgaggcgcac
tttacgagcgcccgtgcggaacgcgaactgggttggatggcgcgcgatttctcggtaagc
gtccgcgatacacttagctggattaagacggaattacttcccgcaggggccgcatga

DBGET integrated database retrieval system