KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0459Help
Entry
Lferr_0459        CDS       T00758                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00330  Arginine and proline metabolism
afe00332  Carbapenem biosynthesis
afe01100  Metabolic pathways
afe01130  Biosynthesis of antibiotics
afe01230  Biosynthesis of amino acids
Module
afe_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Lferr_0459
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Lferr_0459
Enzymes [BR:afe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Lferr_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF2300
Motif
Other DBs
NCBI-ProteinID: ACH82713
JGI: Lferr0459
UniProt: B5ELU1
Position
complement(431527..432657)
Genome map
AA seq 376 aa AA seqDB search
MSRDLKTAQRWVIKIGSSLLTNNGQGLDLAAIEAWVTQILVLRRHGIELVLVSSGAVAAG
MERLGWSTRPTSLHQLQAAASVGQAALIQVYEDFLRRGNVHGSQVLLTHEDLQDRQRYLN
ARSTLRILLEMGVVPIINENDAIASAEIRFGDNDTLAAMVANLLEADLLVILTDQAGLYD
RDPRHDPHAGLLSEVQAGDPELLRMAGGAGTMLGSGGMITKVRAASRAAQSGAATLIAPG
SADNILLRIWSGEEVGTYFRPGVAKLAARKRWLAGQLRPSGTLHLDAGAVRVLREKGSSL
LPVGITASEGDFQRGDLVRCVDPEGHEVARGLVNFAQHEVLLRLGKGSKALCALFGDVDE
FEIIHRDNLVLSSDHG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgcgacctcaaaactgcgcaacgctgggtcataaaaatcggcagcagcctgctc
accaataacggtcagggccttgatctcgccgccatcgaggcctgggttacgcaaatactg
gtgctgcgacggcatggcattgaactggtgctggtttcttcgggcgcggtagctgccggc
atggagcgcctcggctggtcgactcgccctacgtcactccaccaactccaagcggctgcc
agcgtcggccaggctgcgctcattcaggtttatgaagattttctgcgccggggcaacgtg
catggcagccaagtcctgctgacccatgaagatttgcaggatcgtcagcgttacctcaac
gcccgctccaccctgcgcatcttgctggagatgggtgtagtccccattatcaatgaaaat
gacgccattgccagcgccgagatccgctttggcgataatgacaccctggcggccatggtc
gctaatctgctggaagccgacctactggtgatactcaccgatcaggccgggctttatgac
agggacccgcgccacgacccccatgccggcctgctttcggaagtacaggccggagacccg
gaactgctacggatggctggtggtgccgggacaatgctggggagcggaggcatgatcacc
aaggtgcgggcggccagccgtgccgcccagtcgggcgccgccacccttatcgccccgggc
agcgccgacaacatcctgttacgcatctggtccggggaagaggtggggacgtattttcgt
ccgggcgttgccaaactggccgcgcgcaagcgctggctggcagggcagttgcgcccgtcc
gggacactccatctggacgcgggcgccgtgcgggtactccgggaaaagggcagcagtctg
cttccggtcggtattactgccagcgagggcgatttccaacgcggcgacctggtgcgctgt
gtggacccggaaggtcatgaggtcgcgcgtggcctggtgaacttcgcgcagcatgaagtc
ctgctgcggctaggtaagggcagcaaggcactctgcgcattgttcggcgatgtggacgag
ttcgagatcatccaccgtgacaacctggtgctcagcagcgaccacggctaa

DBGET integrated database retrieval system