KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0595Help
Entry
Lferr_0595        CDS       T00758                                 

Definition
Acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:afe00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
555045..555593
Genome map
AA seq 182 aa AA seqDB search
MAALQYAETVQRITDTARIAATLAPLGVTLQAIPVTGAGVAALLTELQPDPEAQAALLTA
LDDVFRRLQRERGYQERDLVVLYPGHPQLAELTARFHRVHTHDDEEVRYIVDGEGVFGFV
LEDGAQVELTVHAGDYVHIPAGVEHWFRLTDAQRIKAVRYFSARGGWTPHYTDRAMRSFP
NP
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcggctttgcaatatgcggaaacggtgcagcggatcacggatacggcgcggatcgcc
gccacgctggcgcccctgggcgttaccttgcaggcgattccggtgaccggggcgggggtc
gcggcgctgctgaccgagctgcaacccgatccggaggcacaggcggcgttgctgacggcc
ctggatgacgtcttccggcgtttgcagcgggagaggggctatcaggagcgggatctggtg
gtgttgtatcccgggcatccgcagttggcggagctcaccgcccgtttccatcgcgtgcat
acccatgacgatgaagaggtgcgctatatcgtggacggggaaggcgttttcggcttcgtt
ctggaagacggcgcgcaagtcgagctgaccgtgcatgcaggggattatgtccatatcccg
gcgggggtggagcactggtttcgtctcacggatgcgcaacggatcaaggcggtgcgctac
ttcagcgcgcgcggcggctggacaccgcattataccgatcgcgccatgcggtctttcccc
aacccatga

DBGET integrated database retrieval system