KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0629Help
Entry
Lferr_0629        CDS       T00758                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
Enzymes [BR:afe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Lferr_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 RrnaAD Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ACH82883
JGI: Lferr0629
UniProt: B5EMV3
Position
588248..588973
Genome map
AA seq 241 aa AA seqDB search
MAASLLALSPEVGMISPRTRGRMVLRLRAEGIRDERVLDAMNRVPRHRFVAQALAGRAYE
PVSLPIGYGQTISQPWMVARMMEAILEEREVPRRVLEIGTGSAYQTAVLAELGAEVFSIE
RIGPLQERATALLGRLGYRQVHLQHGDGSGGWPEKAPFDAMVITAAVPCALAPLYRQLCA
GGSLVMPVEEGGRQHLQVSHWDGSTARVIALGSCHFVPLLAGTVSVASGECADDKRDWRR
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttcgttgctagccctgagtcctgaagtcggcatgatttccccgcgcacgcgg
ggaagaatggtgctccgtctgcgcgcggaaggcatccgtgatgagcgggtgctggacgcg
atgaaccgggttccgcgtcatcgctttgtcgcccaagcgctggcggggcgggcctatgag
ccggtatcgctgcccatcggttacggacagaccatctcccagccctggatggtggcgcgg
atgatggaagcgattctggaggagcgggaggtgcccaggcgggtcctggagatcggtaca
gggtccgcttaccagaccgccgtgctggcggagctaggggcggaggtcttcagtatcgag
cgtatcggcccgctgcaggaaagggcgaccgcgttgctgggcaggctgggctatcgccag
gtgcacctgcagcacggcgatggcagcggcggctggccggaaaaagccccctttgacgca
atggtcattaccgctgccgtgccctgcgcactggcgcccctttaccgccagttgtgcgcc
ggaggcagtctggtaatgccggtggaggagggggggaggcagcatttgcaggtcagtcat
tgggatggcagcactgcgcgagtgattgccctgggcagttgccattttgtccccttgcta
gcgggtaccgtttctgtggcctcaggagaatgtgcggatgataaacgcgattggagacga
ggatga

DBGET integrated database retrieval system