KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0629Help
Entry
Lferr_0629        CDS       T00758                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
Enzymes [BR:afe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Lferr_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
588248..588973
Genome map
AA seq 241 aa AA seqDB search
MAASLLALSPEVGMISPRTRGRMVLRLRAEGIRDERVLDAMNRVPRHRFVAQALAGRAYE
PVSLPIGYGQTISQPWMVARMMEAILEEREVPRRVLEIGTGSAYQTAVLAELGAEVFSIE
RIGPLQERATALLGRLGYRQVHLQHGDGSGGWPEKAPFDAMVITAAVPCALAPLYRQLCA
GGSLVMPVEEGGRQHLQVSHWDGSTARVIALGSCHFVPLLAGTVSVASGECADDKRDWRR
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttcgttgctagccctgagtcctgaagtcggcatgatttccccgcgcacgcgg
ggaagaatggtgctccgtctgcgcgcggaaggcatccgtgatgagcgggtgctggacgcg
atgaaccgggttccgcgtcatcgctttgtcgcccaagcgctggcggggcgggcctatgag
ccggtatcgctgcccatcggttacggacagaccatctcccagccctggatggtggcgcgg
atgatggaagcgattctggaggagcgggaggtgcccaggcgggtcctggagatcggtaca
gggtccgcttaccagaccgccgtgctggcggagctaggggcggaggtcttcagtatcgag
cgtatcggcccgctgcaggaaagggcgaccgcgttgctgggcaggctgggctatcgccag
gtgcacctgcagcacggcgatggcagcggcggctggccggaaaaagccccctttgacgca
atggtcattaccgctgccgtgccctgcgcactggcgcccctttaccgccagttgtgcgcc
ggaggcagtctggtaatgccggtggaggagggggggaggcagcatttgcaggtcagtcat
tgggatggcagcactgcgcgagtgattgccctgggcagttgccattttgtccccttgcta
gcgggtaccgtttctgtggcctcaggagaatgtgcggatgataaacgcgattggagacga
ggatga

DBGET integrated database retrieval system