KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0634Help
Entry
Lferr_0634        CDS       T00758                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afe01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:afe00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:afe00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
592945..594075
Genome map
AA seq 376 aa AA seqDB search
MSRYTGIIDHYRAFLPLAPETPAVSLGEGNTPLIECINLPRQLGLDLRLFLKFEGLNPTG
SFKDRGMAMAVTKAKEDGSEMVICASTGNTSAAAAAYAARAGMRAFVVIPEGKIALGKLS
QAMMHGAMVLQIRGNFDAGMQIVQEVAANAPITLVNSVNPYRLQGQKTAAFEIIEALGEA
PDYHALPVGNAGNITAHWMGYCEATDGRTDKSQPLTASCKFCNGTCSYGHGKAGKRPKML
GFQAAGSAPFIVGHYVKDPETIATAIRIGHPMSWDQAHRVQAESGGWFGSHSDAEILEAQ
RWLAQYEGVFCEPASATSVAGVVAEARAGKIEAGATVVCTLTGHGLKDPDTAIAQGGEVL
TVDASLEAVQRAILDR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttataccggcattatcgaccattaccgcgccttcctgcccctggctcctgaa
accccggcggtgagcctgggtgagggcaatacgccactgatcgagtgtatcaacctgccc
cgccagcttggcctcgatctccgccttttcctcaaatttgagggcctgaatcccaccggc
tccttcaaggaccgtggtatggccatggcggtgaccaaggccaaggaagacggcagcgag
atggtgatctgcgcctccaccggcaacacttcggcggcagcggcggcctatgcggcgcgg
gcgggaatgcgcgccttcgtggtgattccggaaggcaagattgccctcggcaagctctct
caggcgatgatgcatggtgccatggtgttgcagattcgcggcaacttcgatgcgggcatg
cagatcgtccaggaagtggcggccaatgcgccgattaccctggtgaattcggttaaccct
taccgcttgcagggtcagaagacggcggccttcgagattatcgaagcattgggtgaagcg
cccgattatcacgccctgcccgtggggaatgccggcaatatcaccgcccactggatgggc
tattgtgaagccaccgatggacggaccgataagtcccagcccttgaccgcctcctgcaag
ttctgtaatggcacctgtagctacggtcacggtaaggccggaaaacgaccgaagatgctg
ggttttcaggcggcaggcagtgcccccttcatcgtcggccactacgtgaaggaccccgag
accatcgccacggccatccgtatcggccaccccatgtcctgggatcaggcgcatcgggtg
caggcggaaagcggcggctggtttggcagtcatagcgatgccgagattctggaagcgcag
cgctggctggcgcaatatgagggcgttttctgcgaaccggcctcggcgacttcggtggcg
ggggtggttgctgaggcccgcgccggaaaaattgaagccggtgcgacggtagtctgtact
ctcaccgggcatggcctgaaagatcccgataccgccatcgctcagggtggcgaagtgctc
accgtggatgccagtctggaggcggtgcagcgcgccatcctggatcgctga

DBGET integrated database retrieval system