KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0634Help
Entry
Lferr_0634        CDS       T00758                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lferr_0634
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lferr_0634
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Lferr_0634
Enzymes [BR:afe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Lferr_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
592945..594075
Genome map
AA seq 376 aa AA seqDB search
MSRYTGIIDHYRAFLPLAPETPAVSLGEGNTPLIECINLPRQLGLDLRLFLKFEGLNPTG
SFKDRGMAMAVTKAKEDGSEMVICASTGNTSAAAAAYAARAGMRAFVVIPEGKIALGKLS
QAMMHGAMVLQIRGNFDAGMQIVQEVAANAPITLVNSVNPYRLQGQKTAAFEIIEALGEA
PDYHALPVGNAGNITAHWMGYCEATDGRTDKSQPLTASCKFCNGTCSYGHGKAGKRPKML
GFQAAGSAPFIVGHYVKDPETIATAIRIGHPMSWDQAHRVQAESGGWFGSHSDAEILEAQ
RWLAQYEGVFCEPASATSVAGVVAEARAGKIEAGATVVCTLTGHGLKDPDTAIAQGGEVL
TVDASLEAVQRAILDR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttataccggcattatcgaccattaccgcgccttcctgcccctggctcctgaa
accccggcggtgagcctgggtgagggcaatacgccactgatcgagtgtatcaacctgccc
cgccagcttggcctcgatctccgccttttcctcaaatttgagggcctgaatcccaccggc
tccttcaaggaccgtggtatggccatggcggtgaccaaggccaaggaagacggcagcgag
atggtgatctgcgcctccaccggcaacacttcggcggcagcggcggcctatgcggcgcgg
gcgggaatgcgcgccttcgtggtgattccggaaggcaagattgccctcggcaagctctct
caggcgatgatgcatggtgccatggtgttgcagattcgcggcaacttcgatgcgggcatg
cagatcgtccaggaagtggcggccaatgcgccgattaccctggtgaattcggttaaccct
taccgcttgcagggtcagaagacggcggccttcgagattatcgaagcattgggtgaagcg
cccgattatcacgccctgcccgtggggaatgccggcaatatcaccgcccactggatgggc
tattgtgaagccaccgatggacggaccgataagtcccagcccttgaccgcctcctgcaag
ttctgtaatggcacctgtagctacggtcacggtaaggccggaaaacgaccgaagatgctg
ggttttcaggcggcaggcagtgcccccttcatcgtcggccactacgtgaaggaccccgag
accatcgccacggccatccgtatcggccaccccatgtcctgggatcaggcgcatcgggtg
caggcggaaagcggcggctggtttggcagtcatagcgatgccgagattctggaagcgcag
cgctggctggcgcaatatgagggcgttttctgcgaaccggcctcggcgacttcggtggcg
ggggtggttgctgaggcccgcgccggaaaaattgaagccggtgcgacggtagtctgtact
ctcaccgggcatggcctgaaagatcccgataccgccatcgctcagggtggcgaagtgctc
accgtggatgccagtctggaggcggtgcagcgcgccatcctggatcgctga

DBGET integrated database retrieval system