KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1166Help
Entry
Lferr_1166        CDS       T00758                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00900  Terpenoid backbone biosynthesis
afe01100  Metabolic pathways
afe01110  Biosynthesis of secondary metabolites
afe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Lferr_1166
Enzymes [BR:afe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Lferr_1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh Sacchrp_dh_NADP DUF296
Motif
Other DBs
NCBI-ProteinID: ACH83404
JGI: Lferr1166
UniProt: B5EQQ4
Position
1135721..1136896
Genome map
AA seq 391 aa AA seqDB search
MTRGICILGATGSIGKSTLDVVSRHPDQFRIVALTGNHRVAEMQLLCQQHHPELVVMAAP
EAAQQLRVGLGDAGLKKIQVESGPEALAEAARMSGVDEVMAAIVGAAGLLPTLAAVEAGK
KVYLANKECLVMAGNLFMERVRQHQVTLLPIDSEHNAVFQCFADGKGVRRILLTASGGPF
RTWPAEHLAVVTPDQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFDLPASRIDVMI
HPQSIIHSMVEYVDGSVLAQLGNPDMRTPIAHALAFPERMESGVSSLDLAHGPDLQFEAP
DLQRFPCLALAFDALQAGGAAATVLNAANEIAVQAFLEGHLPFLRIAAVVEDTLGELQPA
APDHLDDVLAIDQLAREVALRHLARHGSGMQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaggcatctgcatactcggggctacgggctccatcggcaagagcaccctggat
gtggtgtcgcgccaccccgaccaattccggatcgtcgcgcttaccggcaatcaccgtgtg
gcagagatgcagttgctgtgtcagcaacatcatcccgagttggtggttatggctgccccg
gaagcggcgcagcagttgcgggtggggctaggcgatgccggcctcaagaagatccaggta
gagagtggcccggaggcgcttgccgaagcggcacgtatgtccggcgtcgatgaggtgatg
gcagccattgtgggcgccgccggcctgttaccgaccctggccgccgtagaagccgggaaa
aaggtctatttggccaacaaggaatgtctggtgatggcgggcaacctcttcatggagcgt
gtgcgacagcatcaggtgacgctgcttcccatcgatagcgagcacaatgctgtattccag
tgctttgcagatggcaaaggcgtgcgccgtattctgctgacggcttccggaggaccgttc
cggacctggccggcggagcatctggcggtggtaacgccggaccaggcctgtgcccatccc
aactgggtcatgggccgaaaaatctccgtagactctgcaaccatgatgaataaggggctg
gaggtcatcgaggcgcattggctctttgacctccccgcctcccggatcgacgtgatgatt
catccccagagcatcatccattccatggtggaatatgtggatggctccgtgctggcgcaa
ctgggcaaccccgatatgcgcacccccattgcccatgctctggcttttccagagcgcatg
gaaagcggggtttcgtctctggatctggcgcatgggccggaccttcagttcgaggcacca
gacttacagcggtttccttgcctggccctcgcttttgatgccctgcaggcagggggagca
gcagcgacggtgctgaacgcggcgaatgagattgccgtacaggccttcctggaagggcac
ctgccatttctacgaattgcggccgtcgtcgaagatacccttggtgaattacagcccgcc
gccccagaccatctggacgatgtgctggctatcgaccaactggcacgggaagtggctctc
cgccacctggcccggcatggatcgggtatgcagtga

DBGET integrated database retrieval system