KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1369Help
Entry
Lferr_1369        CDS       T00758                                 

Definition
dihydroorotase (EC:3.5.2.3)
Orthology
K01465  
dihydroorotase [EC:3.5.2.3]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Lferr_1369
Enzymes [BR:afe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     Lferr_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1327531..1328568
Genome map
AA seq 345 aa AA seqDB search
MVKRFTLIRPDDWHLHLRDGAMMAAALPDTARHFARAIVMPNLQTPITTVDLAQAYRDRI
LAALPADMRFEPLMTLYLTDNMPVSEIAKAKNSGFVQAIKYYPTGATTHSEHGVTDLKRA
YSVLAAMEKLDLPLLLHGEVTDSAVDMFDREAVFIDRHLMPLTRDFPGLRMVLEHITTRA
AVDFVRQAPNNVAATITAHHLLLNRNALFEGGLQPHHYCLPLLKRETQRAALVDAATSGN
PKFFLGTDSAPHSRQAKESACGCAGIYTGHAAMELYTEIFERAGALDRLEAFASFHGSDF
YRLPRNRDTLTLEQRSWTVPEELYFGKDTVVPLRAGKTMAWTVLT
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcgattcactctcatacgccccgacgattggcatctccatcttcgggatggc
gcgatgatggccgcggcactccccgacacggcgaggcattttgcgcgcgccattgttatg
cccaatcttcaaactcccatcacgacagtcgatctggcgcaggcctaccgcgaccgcatc
ctcgcggcactcccagcggatatgcgcttcgagccgctcatgaccctttatctcacggac
aatatgccggtgtccgagatcgcgaaggcaaaaaacagtggctttgtgcaggcgatcaag
tactacccgaccggcgcgaccacccattccgagcatggtgtgaccgatctgaagcgtgcc
tattcagtgctcgcggcgatggaaaaactggatctgccgctgctgctgcacggcgaagtg
accgattcggcggtggacatgtttgaccgtgaggcggtgttcatcgaccggcacctcatg
ccgttgacgcgcgattttcccggcctgcgcatggtgctcgagcacatcaccacacgcgcg
gcggtcgacttcgttcggcaggcccccaacaacgtcgccgcgacgattaccgcgcaccat
ctgctgctcaaccgcaacgcgttattcgagggtgggttacaaccacatcattactgcctg
ccgctcctaaagcgggagacgcagcgcgcagcgcttgtcgacgcagccacgagcggcaac
ccgaagttttttctcggcaccgacagtgcgccgcattcgcgtcaagccaaggagtccgcc
tgcggctgcgctggcatctataccgggcacgctgcaatggaactgtataccgagattttc
gagcgcgccggtgcgcttgaccggctggaggccttcgcaagcttccacgggtccgatttc
taccggctgccgcgcaaccgggacaccctcaccctggagcaacggagctggacggtgcct
gaagaactgtatttcgggaaggacacggtcgtgccgctacgcgccggaaaaacgatggcg
tggacggtgctgacatga

DBGET integrated database retrieval system