KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1395Help
Entry
Lferr_1395        CDS       T00758                                 

Definition
(RefSeq) conjugation TrbI family protein
  KO
K03195  
type IV secretion system protein VirB10
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:afe00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Lferr_1395
Secretion system [BR:afe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer protein [MD:M00333]
   Lferr_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1351397..1352857
Genome map
AA seq 486 aa AA seqDB search
MKSGKDFFSDLLQKKKGLLPAGQQPAGDSRKGPGGQQDPCGQPGPSRPQGPQVSQPGIEV
KPDRDRMATRIKRTPLYIAAAVVGLGAYGGYEYLQSHPMFGNAKPQVQAKTIQPASGTGA
PVAPAHRKQVHKPTVPGGASDTSATAATNSDADQSHPAKAPASTVPKKNPYATQDAAFAS
ALGTGSAGSGAGEGLAWKTPESTPSAQTPTVLPTALPGASLPGASLPDAEPSAAKKTKKK
TPPSLVTRETSPYEILSGSVIPAVLQTGIKSYLPGEITAVVSQNVYSSVNGATLLIPAGA
KLVGTYDTQTALGINRLAVAWTRIEFPNGTTMNLPGYEGAGGAGYAGFAGEVNDHTWLIF
KNALLMSIVDAGMAIASPSTSTSVTGQMSGNVALQDSEQALAQTFGEAESQLLEKYIDIA
PTITIPTGYLFSVVVAHDMVFPGPYDPAMQTGSAMVDQALGPNLNPYGLRPAKGLRPAKG
LHPAKG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcggcaaagactttttctccgatttgctccagaaaaagaaagggctgctcccg
gcagggcaacagcccgccggggatagccgcaaaggccctggcgggcagcaagacccttgc
gggcagccaggccctagcaggccgcaaggcccacaagtcagtcagcccgggatcgaggtc
aagccggacagggaccggatggcgacgcgcatcaagcggacgccgctctatattgcggct
gcggtggtcggactgggcgcctatggcggctatgagtatctgcaaagtcacccgatgttc
gggaacgccaagccgcaggtgcaggccaaaactatccagccggcgagcgggactggcgca
ccggtcgcccctgcgcaccggaagcaggtccacaagcccaccgtgcctggaggggcgtcg
gacacgtcggcaaccgcggccacgaacagtgatgctgaccagtctcatccagcgaaggct
ccagcgtccacagtgcccaaaaagaatccctacgcaacgcaggacgccgccttcgcgtcc
gccctgggtacgggaagcgccgggagcggggccggtgagggccttgcctggaaaacgccg
gagtcaacgccatccgcacagactccgacagttctccctacggccctgccgggtgcatcc
ctgccgggagcatccctgccggacgcggaaccgtcggcagcgaagaaaacaaagaagaag
accccgccgtccctggtgacccgggagacgagcccctacgagattctttccgggtcggtc
attcccgccgttttgcagacgggcatcaagagctatctgccgggagagatcacggcggtg
gtcagccagaacgtctattcgtccgtgaacggggcaacgctcctgatccctgccggcgcc
aaattggtgggcacctatgacacacagacggccctgggcatcaaccggctggccgttgcc
tggacgcgcatcgagtttccgaacggcaccaccatgaacctgccgggatacgaaggggca
ggtggtgctggatacgccggcttcgccggggaggtcaatgaccacacctggctgatcttc
aagaatgcgttattgatgtcgatcgtggatgccgggatggcgattgcttctccgtccaca
tcgaccagtgtgacaggccagatgtccgggaatgtggcgcttcaggacagcgagcaagcc
ctggcacagacctttggggaagccgaatcccagctgctggaaaagtacatcgacatcgca
cccacgatcaccattcccaccggctatctgttctcggtggtggtggcgcatgacatggtc
ttccccggcccctacgacccggccatgcagacgggatcggccatggtcgaccaggcgctt
gggccgaatctcaatccctatgggttacgccctgccaaggggctgcgccctgccaagggg
ttgcaccctgcgaaggggtaa

DBGET integrated database retrieval system