KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1395Help
Entry
Lferr_1395        CDS       T00758                                 

Definition
conjugation TrbI family protein
Orthology
K03195  
type IV secretion system protein VirB10
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:afe00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Lferr_1395
Secretion system [BR:afe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer protein [MD:M00333]
   Lferr_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1351397..1352857
Genome map
AA seq 486 aa AA seqDB search
MKSGKDFFSDLLQKKKGLLPAGQQPAGDSRKGPGGQQDPCGQPGPSRPQGPQVSQPGIEV
KPDRDRMATRIKRTPLYIAAAVVGLGAYGGYEYLQSHPMFGNAKPQVQAKTIQPASGTGA
PVAPAHRKQVHKPTVPGGASDTSATAATNSDADQSHPAKAPASTVPKKNPYATQDAAFAS
ALGTGSAGSGAGEGLAWKTPESTPSAQTPTVLPTALPGASLPGASLPDAEPSAAKKTKKK
TPPSLVTRETSPYEILSGSVIPAVLQTGIKSYLPGEITAVVSQNVYSSVNGATLLIPAGA
KLVGTYDTQTALGINRLAVAWTRIEFPNGTTMNLPGYEGAGGAGYAGFAGEVNDHTWLIF
KNALLMSIVDAGMAIASPSTSTSVTGQMSGNVALQDSEQALAQTFGEAESQLLEKYIDIA
PTITIPTGYLFSVVVAHDMVFPGPYDPAMQTGSAMVDQALGPNLNPYGLRPAKGLRPAKG
LHPAKG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcggcaaagactttttctccgatttgctccagaaaaagaaagggctgctcccg
gcagggcaacagcccgccggggatagccgcaaaggccctggcgggcagcaagacccttgc
gggcagccaggccctagcaggccgcaaggcccacaagtcagtcagcccgggatcgaggtc
aagccggacagggaccggatggcgacgcgcatcaagcggacgccgctctatattgcggct
gcggtggtcggactgggcgcctatggcggctatgagtatctgcaaagtcacccgatgttc
gggaacgccaagccgcaggtgcaggccaaaactatccagccggcgagcgggactggcgca
ccggtcgcccctgcgcaccggaagcaggtccacaagcccaccgtgcctggaggggcgtcg
gacacgtcggcaaccgcggccacgaacagtgatgctgaccagtctcatccagcgaaggct
ccagcgtccacagtgcccaaaaagaatccctacgcaacgcaggacgccgccttcgcgtcc
gccctgggtacgggaagcgccgggagcggggccggtgagggccttgcctggaaaacgccg
gagtcaacgccatccgcacagactccgacagttctccctacggccctgccgggtgcatcc
ctgccgggagcatccctgccggacgcggaaccgtcggcagcgaagaaaacaaagaagaag
accccgccgtccctggtgacccgggagacgagcccctacgagattctttccgggtcggtc
attcccgccgttttgcagacgggcatcaagagctatctgccgggagagatcacggcggtg
gtcagccagaacgtctattcgtccgtgaacggggcaacgctcctgatccctgccggcgcc
aaattggtgggcacctatgacacacagacggccctgggcatcaaccggctggccgttgcc
tggacgcgcatcgagtttccgaacggcaccaccatgaacctgccgggatacgaaggggca
ggtggtgctggatacgccggcttcgccggggaggtcaatgaccacacctggctgatcttc
aagaatgcgttattgatgtcgatcgtggatgccgggatggcgattgcttctccgtccaca
tcgaccagtgtgacaggccagatgtccgggaatgtggcgcttcaggacagcgagcaagcc
ctggcacagacctttggggaagccgaatcccagctgctggaaaagtacatcgacatcgca
cccacgatcaccattcccaccggctatctgttctcggtggtggtggcgcatgacatggtc
ttccccggcccctacgacccggccatgcagacgggatcggccatggtcgaccaggcgctt
gggccgaatctcaatccctatgggttacgccctgccaaggggctgcgccctgccaagggg
ttgcaccctgcgaaggggtaa

DBGET integrated database retrieval system