KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1460Help
Entry
Lferr_1460        CDS       T00758                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lferr_1460
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Lferr_1460
Enzymes [BR:afe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Lferr_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1417743..1418942
Genome map
AA seq 399 aa AA seqDB search
MTDRIGKKRATEPNRWLNRSNLQTDAKRWVIKIGSSLLTNDGQHLDITAIRAWMQQILLL
HQRGVEVVLVSSGSVSAGMQRLGWTDRPVSLKARQAAASVGQSALIHTYEKMLQECAQPE
NDRLYCGQVLLTHDDLRTRRRYLNARSTLRTLLDMNVLPIINENDVVSYSAINLGDNDTL
AALVSNLLDADILVILTDQTGLFDADPRSHPEATLLTEVGAGDPMLERIAGGGGSRMGTG
GMLAKVRAAARAARSGTSTIIADGRRPEVLPRLHQGEAIGTFVHARLPKLAARKRWLAGH
LRSHGVLHLDQGAARAILEEGSSLLPVGVIAVEGTFRRGDLVVCKDPLGRDIARGLINLD
APVAARCCRKQSHELADDPEVLEDVLIHRDNLVINDLLL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcgcatcgggaaaaaacgggccacagaacctaaccgatggttgaatcgttcc
aatctgcaaacggatgcgaagcgttgggtgattaaaattggcagcagcctgctgacgaac
gacggccagcatctggatatcaccgcgatacgcgcatggatgcagcaaattctgctgttg
catcagcgtggtgtggaagtggtactggtgtcctccggatcggtaagcgctggaatgcaa
cgtctgggctggacagatcggccggtttcactcaaagctcgacaagccgcggccagcgtc
ggtcaatccgccctgatacatacctacgagaagatgctgcaggaatgcgcgcagcccgag
aatgaccgtttatactgtggtcaagtgctgttgacccacgatgatcttcgtacccgccgg
cgctacctgaatgcacgctccacgttacgtacgctgctggacatgaacgtgctgcccatc
atcaacgaaaatgatgtggtttcttacagtgcgatcaatctgggcgacaacgacaccctg
gcggcattggtgagcaacctgctggatgccgatatcctggtcattcttaccgatcagacg
ggactgtttgacgctgatccgcgcagtcatcccgaagcaacgctcctgacggaggtgggt
gcaggtgatccgatgctggagcgcattgccgggggaggtggatcccggatgggaacgggc
ggtatgctggccaaggtgcgtgctgcggcacgtgccgcgcgttccggcacgtcgacgatc
attgcggatggacgccgtccggaagtcttgccgcgcttgcatcaaggggaagcgatcggc
accttcgttcatgcccgcttacctaagctggctgcgcggaagcgctggctggccgggcat
ctgcgcagccacggagtgctgcatctggatcagggagcggcccgggcgattctggaggag
ggaagcagcttattgccggtgggcgttatcgcggtagaaggcacattccggcggggggat
ttggtcgtttgcaaagatccgctggggcgggacatcgcccgcggtttgatcaatctcgac
gcgccggtcgctgcccgctgctgccggaaacagagtcatgaactggcggatgatcctgag
gtgctggaagatgtgctgattcatcgtgacaacttggtaatcaacgacttgttactctaa

DBGET integrated database retrieval system