KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1482Help
Entry
Lferr_1482        CDS       T00758                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00010  Glycolysis / Gluconeogenesis
afe00030  Pentose phosphate pathway
afe00051  Fructose and mannose metabolism
afe00052  Galactose metabolism
afe00680  Methane metabolism
afe01100  Metabolic pathways
afe01110  Biosynthesis of secondary metabolites
afe01120  Microbial metabolism in diverse environments
afe01130  Biosynthesis of antibiotics
afe01200  Carbon metabolism
afe01230  Biosynthesis of amino acids
Module
afe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lferr_1482
   00030 Pentose phosphate pathway
    Lferr_1482
   00051 Fructose and mannose metabolism
    Lferr_1482
   00052 Galactose metabolism
    Lferr_1482
  Energy metabolism
   00680 Methane metabolism
    Lferr_1482
Enzymes [BR:afe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Lferr_1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ACH83712
JGI: Lferr1482
UniProt: B5ES41
Position
complement(1440511..1441470)
Genome map
AA seq 319 aa AA seqDB search
MTENNTRSPSIATLTLNPAVDIAYEVPHLIPDQKSHATSTRYDPGGNGINVARALKELLV
YAHSCCVVAGNIGELLQKLLQHHLDDPHCVHVEGETRVNATILQGDPATQFEITGIGPRV
SEPILAEVRETFLGLCKDGFAVLTGSVPPGVDDHFYGDMVDRVRAGGGQSIVDAHGALLQ
HALPHHPFLIKPNSYELSLLRRRELPTLEDVAKEARAIQREGVQYVCVSLGGDGALLVGP
DGSYFAKAPPIQVKSTVGSGDSMVAGLVAALAHGQSPAEALRLAVACGSGTAARPGTEIF
SHNDLDELLQITEARVLDI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaacaacacccgctccccgtccatcgctaccctcaccctcaacccggccgta
gacatcgcctacgaagtgccgcacctgatcccggaccagaagagccacgccacatccacc
cgctacgatcccggcggtaacggcatcaatgtcgcccgcgccctcaaggagctgctggtc
tacgcccatagttgctgcgtcgtggccggcaatatcggcgaactgctacagaagctgctg
caacatcacctggacgatccccactgcgtgcacgtagagggggaaacccgcgtcaacgcc
accattttgcagggggaccccgccacccagtttgaaatcaccggcatcgggccacgggtt
tcagaacctatcctcgccgaagtccgggaaacctttctgggcctgtgcaaagacggtttc
gcggtactcaccggctccgtcccccctggcgtggatgatcatttctatggagatatggtc
gatcgggtccgcgccggaggcggacaatccattgtcgacgcccatggcgccctcctgcaa
cacgcccttccccatcaccccttcctgatcaaacccaatagctatgagctgtccctcctg
cgtcggcgcgagctccccacgctggaggatgtggcgaaggaggcgcgcgccatacagcgg
gaaggggtgcagtatgtctgtgtatccctggggggcgacggagcactgctggtcgggccc
gatggcagctattttgccaaggcaccccccattcaggtgaagtcgacggtcggctcgggc
gactccatggtcgccggtctcgtcgccgcgctggcccacggccaaagcccggcagaggcc
ctgcgcctggccgtcgcctgcggcagcggcacggctgcccggccgggcaccgagatattc
tcccataatgatctggacgaactgctacagataacggaagcgcgtgtactcgacatctga

DBGET integrated database retrieval system