KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1488Help
Entry
Lferr_1488        CDS       T00758                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00010  Glycolysis / Gluconeogenesis
afe00020  Citrate cycle (TCA cycle)
afe00620  Pyruvate metabolism
afe01100  Metabolic pathways
afe01110  Biosynthesis of secondary metabolites
afe01120  Microbial metabolism in diverse environments
afe01130  Biosynthesis of antibiotics
afe01200  Carbon metabolism
Module
afe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lferr_1488
   00020 Citrate cycle (TCA cycle)
    Lferr_1488
   00620 Pyruvate metabolism
    Lferr_1488
Enzymes [BR:afe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Lferr_1488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACH83716
JGI: Lferr1488
UniProt: B5ES45
Position
complement(1447153..1448421)
Genome map
AA seq 422 aa AA seqDB search
MKTEITMPVLSDTMQTGRLTRWNKSVGDAVKKGEAVAEVETDKAILDVEAFSDGYLIGPL
AAVDTDIPVRQVIGYIADAPEAAQTDTGGAAKTPTPGTPPAPPSVTPGAVAEKKTAPPDK
LPPATSTPAATPADSGSPEKPAPLPQPQVVAPQPPHADGLRASPYARALARDLELDILQV
KAGPDGTIHAAQVLAAALAPQDADLRMGPPYTIERPNILRAAVARNMSATLNTPAFLISS
RFAVAPLHAAAKTAGLSLTLALSRACALTVAEDPWFNHAWTREGLAKRSRVDVGIAVDTG
SGLITPVLRDAAKRPLKELTEDWRILLGKVKKGRIYPEDYQGASFYLSNLGVFPQIERFN
AIVPVGASAILAVAAAGSDGLTDFTLSCDHRVIFGADAARFLQRLGKRLEDLSWLAGGGG
QP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgaaatcaccatgccggtattgtccgacaccatgcagaccggtcgcctgacg
cgctggaacaagtcggtgggtgacgcggtaaaaaaaggcgaggccgttgccgaggtcgag
accgacaaggcgattctggacgtggaagccttttccgatggttatctcattggtcctctg
gccgctgtggatacggatatcccggtgcggcaggtgatcggttacatcgccgacgcgccg
gaagcggcacagacggacacgggcggtgcggccaaaacccccacacccggtacaccgccc
gcaccgccttcggttacacccggagcggttgcagagaaaaagaccgcaccgccggataaa
ctgccaccagccacctctacgcccgctgcaacaccggcagattccggctccccggagaag
cccgctcccctcccccagccgcaagtcgtggcaccgcaacccccccatgccgatggttta
cgggcttctccatacgcccgcgccctggcccgggatctggaactcgacatcctccaggtc
aaggccggccccgatggcaccattcacgccgcccaggtgctggccgcagccctcgcacct
caggatgccgatctgcgtatgggaccgccttataccatcgaacgtcccaatatcctgcgc
gccgccgtcgcccgcaacatgtccgccacgctgaatacgcccgctttcctcatcagcagt
cgctttgccgtggcgcccctgcatgccgccgccaagacggccggactgagcctgaccctt
gctctgagccgtgcctgcgccctgaccgtcgcggaagatccctggtttaaccacgcatgg
acccgggaggggctggccaagcgtagtcgggtggatgtgggcatcgccgtagacaccggg
agcggactgattacccccgtgctgcgtgacgcagccaaacggccgctcaaggaactcaca
gaggactggcgcattctgctgggcaaagtcaaaaaaggcaggatttatccggaagactac
cagggtgcgagtttttacctctccaatcttggggttttcccgcaaattgagcgattcaat
gccatcgtgccggtgggcgcttccgccatccttgccgttgcggcggcgggtagtgacggg
ctgaccgacttcactctgagttgcgatcaccgggtgattttcggcgcggatgccgcgcgc
ttcctgcaacgcctgggcaagcggctggaggacctatcctggctggccggtggcggcgga
caaccgtga

DBGET integrated database retrieval system