KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1551Help
Entry
Lferr_1551        CDS       T00758                                 

Definition
polyphosphate kinase (EC:2.7.4.1)
Orthology
K00937  
polyphosphate kinase [EC:2.7.4.1]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Oxidative phosphorylation
RNA degradation
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:afe00190]
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:afe03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1508049..1510154)
Genome map
AA seq 701 aa AA seqDB search
MSEVPAPEKARSAPPLDSPELYFNRDLSILAFNQRVLALADDQRVPLLERLRYLTIVSSN
LDEFFEVRMAGLLQRLKFGAGPLGPDMLGPQREIEAVAKKAHEIISEQYRCLNQRLLPAL
AKEGIRLLRRREWRAAQKRWISNYFQTEVLPLLTPLSLDPAHPFPKVQNKGLNFAIVLEG
QDAYGRHSPIAIVQAPRILPRIIWIPQHLAGPNDFVFLSSVIHEHVQALFPGLTIQGFYQ
FRVTRNSELFVDEEEVDNLLDALADELPLRPFGEAVRLEVANNCPREVVEYLLKHFELSE
SNLYSLQGPVNLSRLAAIIEMVPRPDLLYPPFIPGLPAVCSHPENIFAHLREAPILLHHP
YQSFNPVLDFLRQAVSDPKVIGIKQTLYRTTPDSPVIDALIEAAMAGKQVTAVVELKARF
DEANNIRMAERLEEVGVQVVYGVVNHKVHAKMILILRREEDGIRLYGHLGTGNYHPRNAR
IYTDLSLLTANPDITADMNDLFMHITGMGKAPQLRCLLQSPFTMFQGIQEAIDTEIRHGS
KGRIIVRVNALVEPDLIRALYRASQAGVEIDLVVRGACALRPGIPGVSDHIRVRSIVGRF
LEHSRVYYFGNNGHPRLWISSADWMGRNLFRRLEVAVPITDPDLRARILTETLQLYLEDD
CNAWAMRADGDYEFLRNPLDANCKSAQDRLLEHYNRSSHYG
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggtgcctgcgccggaaaaagcccgttccgcgccgcctctcgacagccctgag
ctgtacttcaaccgagacctcagcatcctcgccttcaaccagcgggtactggccctggct
gacgaccagcgcgtaccgctgctggaacgtttacgctacctgaccatcgtttccagcaat
ctggacgaattttttgaagtgcgcatggccggactgttgcagcggcttaaattcggcgcc
ggccccttgggaccggacatgcttgggccccaacgcgaaatcgaggcagtagcgaaaaag
gcccatgaaatcatttccgaacaataccgatgcctgaatcagcgcctgctgcccgctctg
gctaaggaaggtattcgcttgttgcgccgccgcgaatggcgggcagcgcagaaacgttgg
atcagcaattatttccagacggaggtgctgcctctgctcactcccctgagcctcgacccc
gcccacccctttcccaaggtacagaacaaagggctgaatttcgctatcgttctggaaggc
caggatgcttacgggcgacacagccccatcgccatcgtacaggcgccacgcattctcccc
cgcatcatctggattccgcaacatctggcgggtccgaatgatttcgtgtttctctcctcc
gtcatccacgaacatgtgcaggcgctctttccgggtctgaccatccagggtttttatcag
tttcgggtgacgcgcaacagtgaactctttgtggatgaggaagaggtggacaatctcctc
gacgcgctggccgatgaattaccgctacgcccctttggcgaggcggtacggctggaggtc
gctaacaattgtccgcgggaagtggtggaatatcttctgaaacattttgaactgagcgag
agcaacctgtattcattgcagggtcccgtgaatctgtcacggttggcggccatcatcgaa
atggtcccccgccccgacttgctttatccgcccttcataccggggctgccagcggtttgt
tcacaccccgagaacatattcgcgcatctacgggaggcgcccatcctgctccatcaccca
taccagagcttcaacccggttctggatttcctccgccaggcggtcagcgatccaaaagtc
atcggcatcaagcagacgctgtaccgtaccacccccgactccccggtcatcgacgcgttg
atagaagcggccatggccgggaaacaggtcacggcagtggtcgaactcaaggcccgcttt
gacgaagccaataacatccggatggccgagcgtctggaagaagtgggtgtgcaggtggta
tacggcgtggtcaatcacaaggtgcatgccaagatgattctcatcctgcgccgggaggag
gacgggatccgcctctacgggcacttgggtacgggcaattatcatccccgcaatgcgcgg
atttacactgatctcagcctgctcacggcaaatcccgacatcacggcggacatgaatgac
ctgttcatgcatatcactggcatgggcaaggcaccacaattgcgctgtctgctgcagagt
ccctttacgatgttccagggcatacaggaagccatcgatacggagatccgtcacggaagc
aaaggtcgcatcatcgtgcgggtgaacgcgctggtcgaacccgatctgattcgcgccctg
taccgggcctcccaggccggggtggaaatcgacctggtggtgcgcggcgcctgtgccctg
cgccccggcatcccaggtgtctccgatcatatccgggtacgttccattgtcggccgtttc
ctcgaacacagtcgcgtctattacttcggaaacaacgggcatccccgtctctggatatcg
agcgccgactggatgggacgcaatcttttccgccgtctggaagtcgcagtacccattacc
gaccccgacttgcgcgcccgcatactcacggaaacccttcagctatacttggaagacgac
tgtaacgcttgggcgatgcgtgcggatggtgattatgaatttttacgcaaccccctggat
gccaactgcaaatccgcacaggaccgtctgctggaacactacaacaggagcagtcattat
gggtga

DBGET integrated database retrieval system