KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1712Help
Entry
Lferr_1712        CDS       T00758                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Lferr_1712
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Lferr_1712
Enzymes [BR:afe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Lferr_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1682860..1685307
Genome map
AA seq 815 aa AA seqDB search
MTTEHDAACEGESISAYGTARATVEDQPLNTDDLRKIDAYWRASLYLCLGMLYLRDNPLL
RDPLKPEHIKPRLLGHWGSDAGQCFTYIHFNRLINKYDLNAIYISGPGHGAPAILSQAYL
EGTYSETYPDKSQDIAGMRRFFKQFSFPGGIGSHATPETPGSIHEGGELGYSVSHAFGTV
YDNPDLIALVMVGDGEAETGPLATSWHSNKFLNPITDGAVLPVLHLNGYKINNPTILARI
THEELEALFIGYGYTPYFVEGSDPASMHQAMAATMERCVLKIREFQDKARHTGTAFRPRW
PMIILRSPKGWTAPRKVDGHYLEGFWRAHQIPIPDVVSNPAHLQLLESWMRSYRPEELFD
AQGRLIPELHELAPKGKRRMSANPVANGGLLRRPLDMPDFRVFSIAVQDAGGTRADNVPT
LGHFLREITRRNMQNFRIFGPDETQSNKLDAIYDVTQKVWLGAYFPEDADGGALALSGRV
MEMLSEHTLEGWLEGYLLSGRHGLINSYEAFIHIIDSMFNQHAKWLEKCNELPWRAKVAS
LNLLITGLVWRQDHNGFTHQDPGFLDVVANKSPNVVRIYLPPDANCLLSVTDHCLRSVNY
INVIVADKQTHLQYLDMDAAMAHCAKGAGIWEWASNDMGEEPDVVMASCGDVPTMESLAA
TALLRQHLPDIKIRFVNVVDLFKLVPHTEHPHGMTDREFEALFTSSKPVIFNFHSYPWLI
HRLTYRRPAQHHIHVRGYKEKGNIDTPLELAIRNQTDRFSLAIDAIDRIPRFCDTGSGVR
EILLNLQFACKNHAYEYGVDPQEITDWQWPFRDTP
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggaacacgatgcagcttgtgagggtgagagcatcagcgcctacgggaccgcc
cgagcgacggtcgaagatcaacctctgaacaccgatgatctgcgtaagatcgacgcctac
tggcgggccagtctttacctgtgtctcgggatgttatatctccgggataatccgctgctg
cgggatccgctcaagccggagcacataaagccgcgcctgttaggtcactggggatcggac
gcgggccagtgtttcacttatattcatttcaatcgcctgattaacaaatacgacctgaac
gcgatctatatctccgggccggggcacggggcaccggccatactctctcaagcctacctt
gagggaacgtactcggagacatatccggacaaaagtcaggatatcgcaggcatgcggcga
tttttcaagcagttttccttccctgggggcatcggcagtcacgcgacaccggaaaccccg
ggcagcattcatgagggcggagaactcggctacagtgtttcgcacgcatttggaaccgtc
tacgacaaccccgacctgatcgccctggtcatggtgggcgacggggaggcggaaacgggt
ccccttgccacgagctggcacagcaataaattcctcaatccgattaccgatggcgcggta
ttgccggtgctccatctcaacggctataaaatcaacaaccccaccattctggcccgcatc
acccatgaggaactggaggcattatttatcgggtatggttataccccttattttgtggaa
ggaagcgaccctgcgagcatgcaccaggcgatggctgccaccatggaacggtgcgtattg
aaaatccgggaatttcaggacaaagcgcggcacaccggcacggccttccgtccgcgctgg
ccgatgatcatcctccgctcccccaagggctggaccgcgccccgcaaggtggacggacac
tatctggagggcttctggcgggcacatcagatccccattccggacgtcgtttccaatccg
gcacatctgcaactgttggaatcctggatgcgcagctataggccggaggaactcttcgac
gctcagggtcggctcatccccgagctgcacgaactggccccgaagggtaagcgccggatg
agcgccaatcctgtggccaacggcggtctgctgcgccgccctctggatatgcccgacttt
cgcgtattttccatcgcggtgcaggatgcgggcggaacccgggcggacaatgtgcccacc
ctggggcactttctcagggagattacgcggcgaaacatgcagaacttccgcatcttcggt
ccggacgagacccaatccaataaacttgacgccatatatgatgtcacgcaaaaagtctgg
ctgggggcgtattttcccgaagatgccgatggcggggcattggcgctgagcgggcgggtc
atggaaatgctcagcgaacataccctggaaggatggctggaggggtatctgctcagcggg
cggcacggcctcatcaacagctatgaggccttcattcacatcatcgattccatgttcaat
caacacgccaagtggctggaaaagtgcaacgaattaccctggcgcgccaaggtggcatca
ctcaacctgctgattacgggtctggtctggcgccaggaccacaacggcttcacccaccag
gacccaggttttctggacgtcgtcgccaacaagagccccaatgtcgtgcgcatctatctt
ccacccgatgccaactgcctgctctcggtgacggatcattgcctgcgaagcgtgaattat
atcaatgtgattgtcgcggataagcaaacgcatctgcagtatctggacatggacgctgcc
atggcgcactgcgcaaagggtgccggaatatgggaatgggccagtaacgacatgggagaa
gaacccgacgtggtcatggccagttgcggtgacgtacccaccatggaatctctggcggcg
accgccctcttacgccagcatctacccgatataaaaatacgctttgtgaatgtcgtcgat
ctcttcaaactggtgccccataccgaacacccccacggcatgacggaccgtgaattcgag
gcactcttcacctcctcaaaaccggttattttcaattttcactcctatccctggctgata
caccggctcacctaccgccgccccgcccagcaccacattcatgtacggggctataaggaa
aaggggaacatcgacacaccgctggaactcgccatccgcaaccagacggaccggttcagc
ctggctattgatgccattgaccggatcccccgtttttgcgacacgggttccggtgtgcgt
gagatactgctcaacctgcaattcgcctgtaaaaatcatgcatacgagtacggcgtggac
ccgcaggaaatcaccgactggcaatggcctttccgggatactccctga

DBGET integrated database retrieval system