KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1726Help
Entry
Lferr_1726        CDS       T00758                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lferr_1726 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lferr_1726 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lferr_1726 (trpA)
Enzymes [BR:afe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lferr_1726 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1699070..1699888)
Genome map
AA seq 272 aa AA seqDB search
MSRLAGLFVQLRDAGRAALIPFMTAGDPSLTATVPLMHALVAAGADAIELGMPFSDPMAD
GPSIQRASERALARGVKLRMVLEWVREFRTTNSHTPVILMGYLNPVEAMGITSFAEAAAT
AGVDGVILVDLTPEEGRGEAVVLRQRGIDPIFLLAPTSGPERVATVRSMGSGFVYYVSLR
GITGAAQADWAEVLERVQHLHRQLGLPVAIGFGIRDAATVARVATGADAVVVGSALVDQL
AACATDQEAIAAAIRFVEPLAQAVRSTERRGA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtctcgccgggctgtttgtccaactccgggatgcgggtcgcgccgccctcatt
cctttcatgacggcgggtgacccatccctgaccgcgaccgtgcccctgatgcacgcgctg
gtcgccgcgggggccgatgccatcgaactggggatgcccttttccgaccccatggccgat
ggtcccagcatccagcgcgccagtgagcgggcgctggcgcgaggggtgaagctgcgcatg
gtcctggagtgggtgcgcgaattccgcacgaccaacagtcacacgcccgtcattctcatg
ggttatctgaatccggtggaagccatgggtataacctcgttcgccgaggctgccgcgacg
gcgggggtggacggtgtcattctggtggatctgactccggaggaggggcgaggtgaagcc
gtcgttctccgccagcggggtatcgatcccattttcctgctggcgccgaccagcgggccg
gaacgcgtggcgaccgtccgcagtatgggcagtggttttgtatattatgtatctctgcgc
ggtattaccggtgcagcccaggcggactgggcggaagttctggagcgggtacagcacctg
caccggcaactgggcctgcccgtggccatcggttttggcattcgcgatgcagcgacggta
gcgcgggtggcgaccggggccgacgcggtggtcgtcggcagtgcactggtcgatcaactg
gcggcgtgtgcgacggatcaggaagccattgcggcggccatccgctttgtcgagccgctg
gcccaggccgtccggagtacggaaaggagaggcgcatga

DBGET integrated database retrieval system