KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1727Help
Entry
Lferr_1727        CDS       T00758                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00260  Glycine, serine and threonine metabolism
afe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afe01100  Metabolic pathways
afe01110  Biosynthesis of secondary metabolites
afe01130  Biosynthesis of antibiotics
afe01230  Biosynthesis of amino acids
Module
afe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lferr_1727
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lferr_1727
Enzymes [BR:afe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lferr_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ABC_membrane
Motif
Other DBs
NCBI-ProteinID: ACH83949
JGI: Lferr1727
UniProt: B5EK18
Position
complement(1699885..1701084)
Genome map
AA seq 399 aa AA seqDB search
MGTYALPDAFGHYGPYGGRFVAETLIPALEELERAYQEAQRDPEFRAELHSELRQFVGRP
NPLYHAGRLSRELGGAQIYLKREDLNHTGAHKINNAVGQALLARRMGKKRVIAETGAGQH
GVATATVATRYGMECLVYMGEEDIQRQSSNVFRMRLLGAQVTAVSSGTRTLKDALNEALR
DWVTNVESTFYVIGTVAGPHPYPVMVRDFHRVIGDEARAQCLELTGRLPDCLIACVGGGS
NAIGLFYPFIEDRAVRMIGVEAGGLGLGTGQHAAPLTTGRPGVLHGNRTYLMEDEDGQIL
PTHSISAGLDYPGVGPEHAYLKDTGRAEYVAATDEEALAAFHRLCRTEGIIPALESAHAL
AHAFRLAPTMRSDQTIIVNLSGRGDKDIHTVAALEGIHL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgggaacttatgctttgccggacgcgttcggacactatggtccttacggcgggcgtttc
gttgcagaaaccctgattccggcgctggaggaactggagcgtgcctaccaggaggcgcag
cgggatccggagtttcgtgccgagctgcacagtgaactgcgccagttcgtcggtcgtccc
aatccactctatcatgccgggcgcctttccagggagttgggtggagcgcaaatttacctc
aagcgggaggacctcaaccacaccggcgcgcacaaaatcaataatgccgtgggtcaggcg
ctgctcgcccggcgtatgggcaaaaaacgggtaatcgccgagacgggcgcggggcagcat
ggtgtcgccacggcgacggtcgcgacccgctatggcatggaatgcctggtgtatatgggc
gaggaagatatccagcgccagtccagcaatgtgtttcgcatgcgtttgctgggggcgcag
gtgacggcggtcagcagcggtacccgcaccctgaaggatgcgctcaacgaagctttgcgg
gactgggtaaccaatgtcgaaagcactttttatgtgatcggaacggtggcgggaccgcat
ccctatccggtcatggtgcgggactttcaccgggtcattggcgatgaagcgcgggcgcag
tgcctcgaattgacgggacggctccccgattgtctgatcgcctgcgtggggggggggagt
aatgccattggcctgttttatccctttatcgaagaccgggcggtgcggatgatcggcgtc
gaagcgggtggtctgggccttggcaccggacaacacgccgcccccctgaccaccggacgt
ccaggggtattgcatggtaaccggacctacctgatggaagacgaagacgggcagattctg
ccgacccactccatctcggcggggctggattatccgggggtgggaccagagcatgcctat
ctgaaggataccggtcgggcagagtatgtggcggctaccgatgaagaagcgctggccgcc
ttccatcgcctgtgccgcaccgagggcatcattccggcgctggaaagcgcacatgcgctg
gctcacgccttccgcctggcgcccaccatgcgctctgatcagaccattatcgtcaacctt
tccgggcgaggcgataaggatatccacaccgtcgccgccctggagggtattcatttatga

DBGET integrated database retrieval system