KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1744Help
Entry
Lferr_1744        CDS       T00758                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00010  Glycolysis / Gluconeogenesis
afe00071  Fatty acid degradation
afe00350  Tyrosine metabolism
afe00625  Chloroalkane and chloroalkene degradation
afe00626  Naphthalene degradation
afe01100  Metabolic pathways
afe01110  Biosynthesis of secondary metabolites
afe01120  Microbial metabolism in diverse environments
afe01130  Biosynthesis of antibiotics
afe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lferr_1744
  Lipid metabolism
   00071 Fatty acid degradation
    Lferr_1744
  Amino acid metabolism
   00350 Tyrosine metabolism
    Lferr_1744
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lferr_1744
   00626 Naphthalene degradation
    Lferr_1744
Enzymes [BR:afe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Lferr_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ACH83966
JGI: Lferr1744
UniProt: B5EKD1
Position
1720783..1721790
Genome map
AA seq 335 aa AA seqDB search
MHAMVLEEVGRPLVPTELPRPRPQPGQVLVKILACGVCRTDLHVVDGELPNPKLPLVPGH
EVVGQIESVGSPDISLQTGQMVGIPWLAWTCGACEYCRAGRENLCDQARFHGYTVDGGYA
EYMVADARYCFPLPDIYANPEGAPLLCAGLIGFRALRFAAGRRRLGLYGFGAAAHLLIQV
ARYQGMEVYAFTRPGDSKAQDLAIKLGAVWVGGSEVLPPQPLDAAILFAPVGALIPIALQ
AVKKGGVVISAGIHMSDIPAFPYSLLWEERQVRSVANLTRKDAEDYFPLARRVPVQSHIT
TYPLAMANVALADLRGGAVHGAAVLVMGAWQERET
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccatggttctggaagaggtgggtaggcctttggtgcccactgaattgccgcga
ccgcggccacagccgggccaggtcctggtaaaaatactggcgtgcggagtgtgccgtacc
gatctgcatgtagtggacggtgaattgcccaaccccaaactaccactcgttcccggccat
gaagtagtcggccagatagaatcggtgggaagccccgatatttccttacagaccggtcag
atggtgggaattccctggctcgcatggacctgcggtgcctgcgaatattgtcgagcagga
cgggagaatctttgtgaccaggcgcgttttcatggctacaccgtggatggcggttacgcc
gagtatatggtcgccgatgcgcgttactgcttccctcttccagacatttacgccaatccg
gaaggtgccccgctgttgtgtgcggggctcatcggctttcgggccttacgttttgccgcg
ggaagacgacgcctgggtctttatggattcggcgctgccgcgcatttactgattcaggta
gcgcgttatcaaggcatggaggtctatgcatttacccgcccgggcgatagcaaggcacag
gatctagcgatcaaattgggggctgtgtgggtaggtggatcggaggtcctgccgccacaa
ccgctggatgcggcaattttgtttgcaccggttggagccctgatacctattgctcttcag
gcggtcaagaaagggggtgttgtgatcagtgcggggattcacatgtcggatatcccagct
ttcccctattccttactctgggaggagcgacaggtgcgatcggttgccaacctgacgcgc
aaagatgccgaggactatttcccactggcacgacgggtcccggtgcaaagccatatcacg
acgtatcctttggccatggcgaatgtggcattggcggatttgagaggtggcgcggtccac
ggtgccgcggtactggttatgggggcatggcaggaacgcgagacgtga

DBGET integrated database retrieval system