KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1744Help
Entry
Lferr_1744        CDS       T00758                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Lferr_1744
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lferr_1744
  Lipid metabolism
   00071 Fatty acid degradation
    Lferr_1744
  Amino acid metabolism
   00350 Tyrosine metabolism
    Lferr_1744
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lferr_1744
   00626 Naphthalene degradation
    Lferr_1744
Enzymes [BR:afe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Lferr_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1720783..1721790
Genome map
AA seq 335 aa AA seqDB search
MHAMVLEEVGRPLVPTELPRPRPQPGQVLVKILACGVCRTDLHVVDGELPNPKLPLVPGH
EVVGQIESVGSPDISLQTGQMVGIPWLAWTCGACEYCRAGRENLCDQARFHGYTVDGGYA
EYMVADARYCFPLPDIYANPEGAPLLCAGLIGFRALRFAAGRRRLGLYGFGAAAHLLIQV
ARYQGMEVYAFTRPGDSKAQDLAIKLGAVWVGGSEVLPPQPLDAAILFAPVGALIPIALQ
AVKKGGVVISAGIHMSDIPAFPYSLLWEERQVRSVANLTRKDAEDYFPLARRVPVQSHIT
TYPLAMANVALADLRGGAVHGAAVLVMGAWQERET
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccatggttctggaagaggtgggtaggcctttggtgcccactgaattgccgcga
ccgcggccacagccgggccaggtcctggtaaaaatactggcgtgcggagtgtgccgtacc
gatctgcatgtagtggacggtgaattgcccaaccccaaactaccactcgttcccggccat
gaagtagtcggccagatagaatcggtgggaagccccgatatttccttacagaccggtcag
atggtgggaattccctggctcgcatggacctgcggtgcctgcgaatattgtcgagcagga
cgggagaatctttgtgaccaggcgcgttttcatggctacaccgtggatggcggttacgcc
gagtatatggtcgccgatgcgcgttactgcttccctcttccagacatttacgccaatccg
gaaggtgccccgctgttgtgtgcggggctcatcggctttcgggccttacgttttgccgcg
ggaagacgacgcctgggtctttatggattcggcgctgccgcgcatttactgattcaggta
gcgcgttatcaaggcatggaggtctatgcatttacccgcccgggcgatagcaaggcacag
gatctagcgatcaaattgggggctgtgtgggtaggtggatcggaggtcctgccgccacaa
ccgctggatgcggcaattttgtttgcaccggttggagccctgatacctattgctcttcag
gcggtcaagaaagggggtgttgtgatcagtgcggggattcacatgtcggatatcccagct
ttcccctattccttactctgggaggagcgacaggtgcgatcggttgccaacctgacgcgc
aaagatgccgaggactatttcccactggcacgacgggtcccggtgcaaagccatatcacg
acgtatcctttggccatggcgaatgtggcattggcggatttgagaggtggcgcggtccac
ggtgccgcggtactggttatgggggcatggcaggaacgcgagacgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system