KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1795Help
Entry
Lferr_1795        CDS       T00758                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
Enzymes [BR:afe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Lferr_1795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_18 MTS GCD14 Methyltransf_32 Methyltransf_11 DOT1 Methyltransf_4 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ACH84016
JGI: Lferr1795
UniProt: B5EKI1
Position
1775097..1775750
Genome map
AA seq 217 aa AA seqDB search
MDFDILRRTMIDTQIRTWDVLDPRVLNAVAQVKREDFVAAPYRHLAFADFTLPLAHGETM
WSPKMEARVVQELDLREQDRVLEIGTGSGYLTALMAQLAGMVHSVEDRADLSRTAADHLR
TQGVQNACLHIGDGSEGWADNAPYDAICITGSLPVLPDIFKQQLTVGGRLVAILGTGPAM
GVRRILHSRPGVFESSELFETEIPPLRHQPLPAHFVF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggactttgacatcctccgccgtaccatgatcgacacccagatccgcacctgggatgtg
ctcgacccccgtgtgctgaacgccgtggcgcaggtgaagcgcgaggacttcgtagccgct
ccctaccggcacctggctttcgctgattttaccctgcctctggcgcacggtgaaaccatg
tggtcgccgaaaatggaggctcgagtcgtgcaggagctggatttgcgggaacaggaccgg
gtactggagatcggcaccggaagcggctatctgaccgccctgatggcacaacttgcggga
atggtacacagcgtcgaagaccgcgccgatctctcccggacagcggcagatcatctgcgc
acacaaggtgttcagaatgcctgtctgcacattggcgacggctccgagggctgggcggac
aatgccccatatgatgccatctgcatcaccggctccctgccggtactgccggatatcttc
aaacagcaactgacggtcggtggacggctggtcgccattctcggtaccggtccggccatg
ggggtgcggcgcatcctgcactcccggccgggtgtttttgagagctcggagctttttgag
acagagatcccgcctttgcgtcatcagccgctaccggcccactttgtgttctga

DBGET integrated database retrieval system