KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1858Help
Entry
Lferr_1858        CDS       T00758                                 

Definition
DNA polymerase III subunit chi HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:afe00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:afe00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:afe03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:afe03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:afe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1838209..1838634
Genome map
AA seq 141 aa AA seqDB search
MPVASFYTLPPTLLTAHEQRRGMCRVIAKVWQVMGEADILCPDTEAGQTLDDLLWTFQAG
AFVPHARGAGEPVRIHENGAWPLQGKALVLCGLDKLPAPLPPCERLIDFIPVAEQLRGFA
RERYRQLKNAGFTMQVHPLEA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgtcgcctcgttttataccctgcccccgacactgcttaccgcgcacgaacagcgg
cgcggcatgtgccgggtgattgccaaggtgtggcaggtcatgggagaagcagatatcctg
tgtccggatacggaggccggacagaccctggatgacctgctctggacctttcaggcggga
gctttcgtgccccatgcccggggtgcaggagaaccggtacgcatccacgagaacggtgca
tggcccttgcagggcaaggcgctggtgctctgcgggctggacaaattgccagcgcccctc
cccccctgcgagcggctcatcgacttcattccggtcgcagagcaactgcgcggcttcgcc
agagaacgatacagacaattaaagaacgcaggattcaccatgcaggtgcatcccctggaa
gcctga

DBGET integrated database retrieval system