KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1878Help
Entry
Lferr_1878        CDS       T00758                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1861806..1864166
Genome map
AA seq 786 aa AA seqDB search
MGNPSKAPAAAWRHPVWSTARKSCVGTALGSGKIWFTTGRGIVTEVFYPRIDIPQIRDLG
FIVADDQGFWQELKALPEPRLEMEDPLVPLPIIHHHHDRFDFTLKICADPERDVLLLDFH
LEGDAALRPYLLCSARLGEDAENNCAWVGDWEGRPVLWAEQGPFGLALTCRNADGYPALE
RCTVGEVGASDLWQDFHQNGRMQWAYQEAGPGEVALAGRLPRQGTLALGLGTSKEAAATN
AWSSLAEGFQSRAADYSAGWNAWHQRHPTHHCVSKLPAAAKALYARSTNILKVHEDRTFP
GAMVASLSVPWGESSDSRGGYHLVWSRDLVESAGALLALGAATEARHVLTYLISTQQADG
HWLQNQWLGGKPFWQGVQLDETGFPVLLASALREAQMLENVAVTDMITRALHFIVHEGPV
TGQDRWEEDGGVNLFTLAVAIAALVEGAGFLGGKAGDCALMLADYWNARLEEWTFAHDTD
LARRFQVAGHYVRIIPEDILVQDGAQKEWVLIKNRAHDPHLSAGEQVANDFLQLVRYGLR
SADDPHVTASVKVMDGLLRTDTPCGPVWHRYNGDGYGEHADGSPFDGTGIGRGWPLLVGE
RGHYALAAGEDAVPYINAMAAMTGNSGLLPEQIWESDAIPEKGLFPGHPSGSAMPLVWAH
GEFIKLCHSAAQGRPVDRPAQTWKRYQGKVPKIDYRIWRLRQRPRQLPAGQELRLLLRAP
FTVHWGSNGWQAIQDTESEDWGLGHVATLPVQKLRVGDSVQFTILWRDSGDWQGEDFHID
IVGGGA
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaacccaagcaaagcgcccgctgccgcttggcgccaccccgtctggtccaccgcc
cggaaatcctgcgtgggcacggcgctgggcagcggaaaaatctggtttaccacgggccgg
gggattgtcaccgaagtcttttacccgcgtatcgacatccctcagattcgcgacctcggc
ttcatcgttgccgatgatcaggggttctggcaggaactgaaggccctgccagaaccccga
ctggaaatggaggaccccctcgttcctctgcccatcatccaccatcatcacgaccgcttc
gacttcaccctgaaaatctgcgcagacccggaacgggatgtgctcctgctcgacttccat
ctggagggcgatgccgcgctgcggccttatctgctctgctccgcacgtctcggtgaggat
gccgaaaacaactgcgcgtgggtaggtgattgggaaggccggccagtactctgggcagaa
cagggaccttttggcctggcgctcacctgccgcaacgccgacggctatccggcactggaa
cgctgcacggtgggcgaagtgggtgccagtgatctctggcaggattttcatcagaacgga
cggatgcagtgggcatatcaggaggccggaccaggtgaggtggccttggcgggtcgtctg
ccacggcagggcaccctggccctgggtcttggcaccagcaaggaagccgccgccaccaac
gcctggtcctccctggccgagggctttcagagccgcgcggcggattacagcgccggctgg
aatgcctggcaccaacgccatcccacccaccactgtgtcagcaaactgccggcggcggct
aaagccctgtacgctcgctccaccaacattctcaaggtacatgaggatcgtaccttcccc
ggcgcgatggtggccagtctctcggtgccctggggggagtccagcgacagtcgcggcggc
tatcatctggtttggtcccgagatctggtggagagcgcaggggccctgctcgccctcggg
gccgccaccgaagcacgacacgtactgacctatctcatcagcacccaacaggccgacggg
cactggttacagaatcaatggctgggcggcaaacccttctggcaaggggtgcagctcgat
gaaacgggattcccggtgctcctcgcctcggcattgcgcgaggcgcagatgctggagaac
gtagcggtcaccgacatgatcacccgtgccttgcactttatcgtccacgaggggccggtg
actgggcaggaccgctgggaggaagatggcggcgtcaatctgttcaccctcgcagtggcc
atcgccgcgctggtggagggtgccggcttcctgggcggcaaggccggtgactgtgccctg
atgctggccgattactggaatgcacgactggaggaatggacctttgcgcacgataccgac
cttgccagacgctttcaggtagccggccactacgtccgcatcatcccggaggatatcctg
gtgcaggatggcgcccagaaggagtgggtactgatcaagaaccgggctcatgatccgcac
ttgtccgctggcgaacaggtcgccaacgacttcctgcaactggtgcgttacggtctgcgc
agcgcggacgatccgcacgtcaccgcctcggtcaaagtcatggatggactgctccgaaca
gacactccctgcggcccggtctggcaccgctacaatggcgacggttacggggaacatgcc
gatggcagcccctttgacggtaccggcatcggtcgtggctggcctttgctggtaggggaa
cggggtcattacgccctcgccgctggcgaagacgccgtgccctacatcaacgccatggcg
gccatgacaggcaacagtggactactgccggaacagatctgggagtccgacgccataccg
gagaagggcctgttccccggccaccccagcggctcggccatgcccttggtctgggcccac
ggtgagttcatcaagctgtgccacagcgctgcgcagggccgtcccgtggaccgcccggcg
cagacctggaagcgctatcagggcaaagtcccgaagatcgactaccggatctggcgtctg
cgccagcggccgcgtcaactgcccgcaggacaggaactgcggctgttgttgcgggcgcct
ttcaccgtacactggggcagcaacggctggcaggcgatacaggataccgagtcggaagac
tggggtctcggccatgtcgctaccctgccggtacagaaattgcgggtcggggacagcgta
cagttcaccatcctctggcgcgacagcggcgactggcagggcgaggattttcatatcgat
attgtcggaggtggcgcatga

DBGET integrated database retrieval system