KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2458Help
Entry
Lferr_2458        CDS       T00758                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Lferr_2458
Enzymes [BR:afe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Lferr_2458
Exosome [BR:afe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lferr_2458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2420335..2422542)
Genome map
AA seq 735 aa AA seqDB search
MTAMQKRGSTGGGPSGDSEDGLAIREARHHDPFAWLGQHTVDGRSVQRAFLPGAFGVEIQ
TPAGWVVMEQSHPAGIFTHQGEVIPVPYRLRWEDRHGFHERHDPYVFGPVLGDVEVYLFG
EGRLYEAYRHLGAHRRHHEGVDGVLFAVWAPNAGRVSVVGDFNDWDGRAHPMRARGQSGI
WELFIPDLATGEIYKFEIRHRDSGAVFVKTDPYAHAFELRPSTAARVVENDHVWEDQDWM
AARTGQDWQHAPMNIYEVHLGSWQRDAAGHFLSYAALAESLVSYCKDMGYTHIELMPVME
HPLDESWGYQVSGYFAPTSRFGTPDGFRAFVDQFHQAGIGVLLDWVPGHFPRDDWGLARF
DGTPLYEHADPREGEHSDWGTYIFNFGRNEVRGFLLANACYWADSFHIDGLRVDAVASLL
YRDYSRQEGEWIPNQYGGRENLEAIDFLREMNVILNERHPGILTIAEESTSWPMVSRPTY
VGGLGFSMKWNMGWMNDTLAYLEQDPVYRRFHQNDLTFSQLYAYSENFVLPLSHDEVVHG
KRSLLDKMPGDAWQRFANLRLLFSYQFAHPGKKLNFMGNEFGQGREWDCGQALDWDLLHW
DWHQGIQRLSRDLARLYRDIPALYAQDFQGEGFSWVDCHDADQSVLSFLRWDRDGGFVLA
VFNFTPVPRRNYRLGVPAAGRYREIFNSDAGAYHGSNVGNLPQQAQDQSWMGLSHSLELV
LPPLGAIYLQLTGVG
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcaatgcaaaagcgtggcagtacggggggcggtccgtccggcgacagtgaagac
ggtttggccattcgtgaggctcgtcatcacgaccccttcgcctggctgggccagcatacg
gttgatgggcggagcgtgcagcgggcctttctgcccggagccttcggcgtggagatacag
acgccagcgggatgggtggtcatggaacagagccatccggccggcattttcacccatcag
ggcgaggtcataccggtgccttaccgcctgcgctgggaggatcggcacggattccacgaa
cgccatgacccttatgtcttcggcccggtgttgggggatgtggaggtgtacctcttcggc
gaggggcgcctctatgaagcctatcgtcacctcggtgcgcaccgtcgccatcacgaggga
gtggatggggtgttattcgccgtatgggcgcccaatgcgggacgggtcagtgtcgtcggt
gatttcaatgattgggacggccgcgcccaccccatgcgcgcgcgtggccagagcggcatc
tgggaactgttcatcccggacctcgccactggcgaaatctacaaattcgagatccgtcac
cgcgattccggggcggtattcgtcaagaccgacccctacgcccatgcctttgagctcaga
ccgagtacggcggcacgcgtggtggaaaatgaccacgtctgggaggatcaggactggatg
gcggctcggaccggtcaggactggcagcacgcccccatgaacatctacgaagtgcatctc
ggttcgtggcagcgtgatgcggcgggccatttcctcagttacgcggcgctggcggaaagt
ctggtgtcctactgcaaggatatgggttatacccacatcgaactgatgccggtgatggag
caccctctggacgaatcctggggctatcaggtgagcggctattttgcacccaccagccgc
ttcggtacgcccgacggcttccgcgcctttgtggatcagtttcatcaggcgggcatcggt
gtgcttctggactgggtgccggggcatttcccccgggatgactgggggctggcgcgcttc
gatggcaccccgttgtatgaacatgccgatccgcgcgagggcgagcacagcgactggggc
acttatattttcaacttcggacgcaacgaggtgcgtggttttctgctggccaatgcctgc
tactgggcggacagtttccatatcgacgggttgcgcgtggatgcggtggcgtccctgctc
taccgcgattattcgcgtcaggagggcgagtggattcccaatcagtacggtggccgggaa
aatctcgaggccattgatttcctgcgcgagatgaatgtgatcctcaatgagcgtcatccg
ggcatcctcaccattgccgaagagtccacgtcctggccgatggtctcccgccccacctat
gtgggcggcctgggtttttccatgaagtggaatatgggctggatgaacgataccctggcc
tacctggaacaggacccggtctaccggcgctttcaccagaacgacctgaccttcagccag
ctttacgcttattcggaaaacttcgtgctgcccttgtcccatgacgaagtggtgcatggc
aagcgttcattgctggacaaaatgccgggggatgcctggcagcgttttgccaacctgcgc
ctgctgttcagctaccagtttgcgcatcccggcaagaaactgaattttatgggcaacgag
ttcggccagggacgggagtgggattgcgggcaggccctggactgggacctgctgcattgg
gactggcatcagggcattcagcggttgagccgagatctggcccgtctctaccgggatatt
ccggccttgtatgcgcaggattttcagggcgagggcttctcctgggtggattgccatgac
gccgatcagtcggtgttgagttttctgcgctgggaccgggacggcggtttcgtgctggcg
gtgttcaattttacgccggtgcctcggcgcaattatcgtctgggggtgccggctgcgggt
cggtaccgggagatcttcaacagcgacgcgggcgcctatcacggcagcaatgtgggcaat
ctgccgcagcaggcccaggatcagtcgtggatgggtctgtcccattcgctggaactggtc
ctgccgcccctgggcgcgatttatctacagcttaccggagtaggctga

DBGET integrated database retrieval system