KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2548Help
Entry
Lferr_2548        CDS       T00758                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:afe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lferr_2548
Enzymes [BR:afe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Lferr_2548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2519649..2521601
Genome map
AA seq 650 aa AA seqDB search
MNQPMTSLMIDQLRAWTSAGWLRPLDLAFAQFLIRLDPQAPALLPLAGALLARLEGEGHT
CIALEDFLGAPERFLDWPAPGHAMLATALGDWPHAAQWTETLARSRCVQVTERNAPVPAN
GAETPLVLSAARLYLRRYWRDQQFIAEALRQRAQQRVADAANPEALRPWLEQLFPASDEP
GDALPWQKIACALALRSHFSIITGGPGTGKTYTAARFMALLMATSSTPLRIVLAAPTGKA
AVRIDESLQSAVGTLPQLSQIPDMTAAFARLRPARTLHSLLGARPDSRRFRHDAANPLEL
DVLVVDEASMIHQEMMAALLRALPPAARLILLGDQDQLASVEAGAVLAELSLGSGKYDAE
TCHYMQASCGAAPRPGDNGPSPLAANIIRLQRSHRFNAEIGALADAVHGGHPETAVRILQ
TAHTGTLAWQPAPAIHRILELARPESAYGRVWQAAGQPPPKDRQQHSAWVKTILNDYAGF
RILCALRQGPWGVTGINRAIEDYLQRQGILQSRGLWYAGRPTLVTRNDPNLGLSNGDIGI
ALPDPDKRLRVYFPNSEEAPRAILPSRLNHTESAWAMTVHKAQGSEFAHTVLILPPEDSP
VLSRELLYTAITRARKCFTLIAPRERLENAIQRQTRRMSGLHAALYDPRR
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcccatgaccagcctcatgatcgaccaactccgcgcctggaccagcgccggc
tggctacggcccctcgaccttgccttcgcgcagttcctcatccgcctggacccgcaggcc
ccggccctcctgcccctggcgggcgctctcctcgcccggctggagggagaaggccacacc
tgcatcgcgctggaagacttcctcggcgcacccgaacgcttcctggactggcctgcgccg
gggcacgccatgctggcaaccgcactcggtgactggccccatgccgcccaatggacagaa
accctcgcccggagccgctgcgtacaggtcaccgagcgcaacgcccccgtcccggcaaac
ggcgcagaaacgcccctggtcctcagtgccgcccgcctctatttgcgccgctactggcgt
gaccagcaattcatcgccgaggccctgcgccagcgcgcccaacagcgcgtcgccgatgcc
gccaaccccgaggcattaagaccctggctggagcaacttttcccggcgtctgacgaaccc
ggcgacgcactcccctggcaaaaaatcgcctgcgccctcgccctgcgcagccacttcagc
atcatcaccggcggccccggtaccggcaaaacctacaccgcagctcgcttcatggccttg
ctcatggcgaccagcagcacacccctgcgcatcgtgcttgccgcccccaccggcaaggcc
gccgtgcgcatcgacgaatccctgcagagcgcggtcggcactcttccgcaattgagccaa
atacccgatatgactgccgccttcgcccgcctgcgtccggcgcgcaccctgcacagcctg
ctcggcgcccgccccgacagtcgtcgctttcgccacgatgctgccaaccccctcgaactg
gacgtactcgtggtggacgaagcctccatgattcatcaggagatgatggccgccctgctc
cgcgccctgccgcctgcggcccgcctcatcctcctcggcgatcaggaccagcttgcctcc
gtcgaagcgggcgcggtgctggccgaactcagtctcggcagcggtaaatatgatgccgag
acctgccactatatgcaggccagttgcggtgccgcgccgcggcccggcgacaacggcccc
agcccccttgccgcaaacatcatccgcctgcaacgcagccatcgcttcaatgcagaaatc
ggcgcgctggcggatgccgtgcatggcggccaccccgaaaccgccgtccgcatcctgcaa
acggcgcacactggcactctcgcctggcaacccgcccctgccatccaccggatactggaa
ctggcccgcccggaaagcgcctatggtcgggtctggcaagccgcgggccagccgccaccc
aaagaccggcaacaacatagcgcatgggttaaaaccatcctcaacgactacgctggcttc
cgcatcctctgtgccctgcgccaaggcccctggggcgttaccggcatcaaccgcgccatc
gaagactacctgcagcgccagggcatcctgcagagccgcggcctttggtatgccggccgc
cccaccctcgtcacccgcaatgaccccaacctcggtctcagcaatggcgacatcggcatc
gccctgcccgacccggataaacgcctgcgcgtctacttccccaatagcgaagaggccccc
cgcgccatcctccccagccgcctcaaccacaccgaaagcgcctgggccatgaccgtccac
aaggcacagggttccgagttcgcccacaccgtcctcatccttcctccggaagacagcccc
gtcctcagccgcgaactgctctacacggccatcacccgcgcccgcaaatgcttcaccctc
atcgccccccgggagcgactggaaaacgccattcagcgccagacgcggaggatgagcgga
ttacacgcggcgttatatgatcccaggcgctga

DBGET integrated database retrieval system