KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2548Help
Entry
Lferr_2548        CDS       T00758                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:afe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lferr_2548
Enzymes [BR:afe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Lferr_2548
DNA repair and recombination proteins [BR:afe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Lferr_2548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 PhoH AAA_22 UvrD-helicase AAA_24 PIF1 DUF2075 AAA_5 UvrD_C Mg_chelatase ResIII AAA_28 AAA_16 ATPase
Motif
Other DBs
NCBI-ProteinID: ACH84742
JGI: Lferr2548
UniProt: B5EPU7
Position
2519649..2521601
Genome map
AA seq 650 aa AA seqDB search
MNQPMTSLMIDQLRAWTSAGWLRPLDLAFAQFLIRLDPQAPALLPLAGALLARLEGEGHT
CIALEDFLGAPERFLDWPAPGHAMLATALGDWPHAAQWTETLARSRCVQVTERNAPVPAN
GAETPLVLSAARLYLRRYWRDQQFIAEALRQRAQQRVADAANPEALRPWLEQLFPASDEP
GDALPWQKIACALALRSHFSIITGGPGTGKTYTAARFMALLMATSSTPLRIVLAAPTGKA
AVRIDESLQSAVGTLPQLSQIPDMTAAFARLRPARTLHSLLGARPDSRRFRHDAANPLEL
DVLVVDEASMIHQEMMAALLRALPPAARLILLGDQDQLASVEAGAVLAELSLGSGKYDAE
TCHYMQASCGAAPRPGDNGPSPLAANIIRLQRSHRFNAEIGALADAVHGGHPETAVRILQ
TAHTGTLAWQPAPAIHRILELARPESAYGRVWQAAGQPPPKDRQQHSAWVKTILNDYAGF
RILCALRQGPWGVTGINRAIEDYLQRQGILQSRGLWYAGRPTLVTRNDPNLGLSNGDIGI
ALPDPDKRLRVYFPNSEEAPRAILPSRLNHTESAWAMTVHKAQGSEFAHTVLILPPEDSP
VLSRELLYTAITRARKCFTLIAPRERLENAIQRQTRRMSGLHAALYDPRR
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcccatgaccagcctcatgatcgaccaactccgcgcctggaccagcgccggc
tggctacggcccctcgaccttgccttcgcgcagttcctcatccgcctggacccgcaggcc
ccggccctcctgcccctggcgggcgctctcctcgcccggctggagggagaaggccacacc
tgcatcgcgctggaagacttcctcggcgcacccgaacgcttcctggactggcctgcgccg
gggcacgccatgctggcaaccgcactcggtgactggccccatgccgcccaatggacagaa
accctcgcccggagccgctgcgtacaggtcaccgagcgcaacgcccccgtcccggcaaac
ggcgcagaaacgcccctggtcctcagtgccgcccgcctctatttgcgccgctactggcgt
gaccagcaattcatcgccgaggccctgcgccagcgcgcccaacagcgcgtcgccgatgcc
gccaaccccgaggcattaagaccctggctggagcaacttttcccggcgtctgacgaaccc
ggcgacgcactcccctggcaaaaaatcgcctgcgccctcgccctgcgcagccacttcagc
atcatcaccggcggccccggtaccggcaaaacctacaccgcagctcgcttcatggccttg
ctcatggcgaccagcagcacacccctgcgcatcgtgcttgccgcccccaccggcaaggcc
gccgtgcgcatcgacgaatccctgcagagcgcggtcggcactcttccgcaattgagccaa
atacccgatatgactgccgccttcgcccgcctgcgtccggcgcgcaccctgcacagcctg
ctcggcgcccgccccgacagtcgtcgctttcgccacgatgctgccaaccccctcgaactg
gacgtactcgtggtggacgaagcctccatgattcatcaggagatgatggccgccctgctc
cgcgccctgccgcctgcggcccgcctcatcctcctcggcgatcaggaccagcttgcctcc
gtcgaagcgggcgcggtgctggccgaactcagtctcggcagcggtaaatatgatgccgag
acctgccactatatgcaggccagttgcggtgccgcgccgcggcccggcgacaacggcccc
agcccccttgccgcaaacatcatccgcctgcaacgcagccatcgcttcaatgcagaaatc
ggcgcgctggcggatgccgtgcatggcggccaccccgaaaccgccgtccgcatcctgcaa
acggcgcacactggcactctcgcctggcaacccgcccctgccatccaccggatactggaa
ctggcccgcccggaaagcgcctatggtcgggtctggcaagccgcgggccagccgccaccc
aaagaccggcaacaacatagcgcatgggttaaaaccatcctcaacgactacgctggcttc
cgcatcctctgtgccctgcgccaaggcccctggggcgttaccggcatcaaccgcgccatc
gaagactacctgcagcgccagggcatcctgcagagccgcggcctttggtatgccggccgc
cccaccctcgtcacccgcaatgaccccaacctcggtctcagcaatggcgacatcggcatc
gccctgcccgacccggataaacgcctgcgcgtctacttccccaatagcgaagaggccccc
cgcgccatcctccccagccgcctcaaccacaccgaaagcgcctgggccatgaccgtccac
aaggcacagggttccgagttcgcccacaccgtcctcatccttcctccggaagacagcccc
gtcctcagccgcgaactgctctacacggccatcacccgcgcccgcaaatgcttcaccctc
atcgccccccgggagcgactggaaaacgccattcagcgccagacgcggaggatgagcgga
ttacacgcggcgttatatgatcccaggcgctga

DBGET integrated database retrieval system