KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2587Help
Entry
Lferr_2587        CDS       T00758                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Lferr_2587
Enzymes [BR:afe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Lferr_2587
Transfer RNA biogenesis [BR:afe03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Lferr_2587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2562980..2563837
Genome map
AA seq 285 aa AA seqDB search
MIADTIDMERIIAIAKEAGDAIMEIYQRDFTVDYKEDSSPLTDADRAAHGIILHGLHALY
PEIPFLSEEGDAIPYEIRKHWGFFWLVDPLDGTKEFIRKNGEYTVNIALIENNRPVLGVV
YAPALDLMYYAKEGAGAWRQDAVQGTQKLPLHVNDSREQKLTVVASKSHRSPETEVYIDE
LRKSTRELEVVSIGSSLKICLVAEGDADCYPRLGPTMEWDTAAAQIIATESGCRVEAAAG
GHKLIYNKKDLLNPYFVVETAVAMFCNGRTVANTRGYEHEPTSDQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctgatactattgacatggaacgaattattgccatcgccaaagaagccggcgat
gccatcatggaaatttatcaacgggattttacggtggattacaaggaggactcctccccc
ctcacggatgccgatcgtgccgcacatgggatcattctccatggccttcatgccctttat
ccggagattccgtttttgtcggaagagggtgatgccattccttatgagatacggaaacac
tggggctttttctggctggtggatcccttggatggtacaaaagagttcatccggaaaaat
ggcgaatataccgtaaacatcgcgctgatcgaaaacaacaggccggtgctcggtgtggtt
tacgccccggcgctggatctcatgtactacgcaaaagagggagcaggggcatggcgccaa
gatgcagtacaggggacccaaaagcttccgttgcatgtcaatgatagtcgggaacagaag
ctgacggtggtggcgagcaaatcccatcgatcgcccgagacggaagtctatatcgacgag
cttcgaaaatccacgcgggaactcgaggtcgtttcgattggcagttcgctcaagatctgc
ctcgtcgccgagggggatgcggattgttatccccgcttggggccaaccatggaatgggat
acggcggcggcccagattattgcgaccgaaagcggctgtagagtagaggctgccgctggc
ggacataaactaatatataacaaaaaagatttattaaatccctattttgttgttgaaaca
gcggtcgccatgttttgcaacggccggacggtggcaaacacgagagggtatgaacatgaa
ccgacttctgatcaatga

DBGET integrated database retrieval system