KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2648Help
Entry
Lferr_2648        CDS       T00758                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lferr_2648
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Lferr_2648
Enzymes [BR:afe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Lferr_2648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2629484..2630755
Genome map
AA seq 423 aa AA seqDB search
MDKLLLRGNGPLRGELRISGAKNAALPCLAATLLAREPVRLCNIPHLRDITTTLELLSTL
GARVLVDGQLGIEVDPRPVHSVVAPYELVKTMRASILVLGPLLARHGSAEVSLPGGCAIG
SRPVSVHLSGLQALGAEITVEDGFVKAQAARLRGTRIVMEMVSVTGTENLLMAATLAEGR
TILENAAREPEIVDLARCLSAMGARISGAGTSVIEIEGVAELHGAEHSVVPDRIETGTYL
VAAAMTGGDICLKRTDAGLLESVLLKLKEAGAEVTTGADTIRIRMKRRPRAVDVRTAPFP
AFPTDMQAQFMAMNCIAEGSSVVTETIFENRFMHVSELQRLGADINADGKTAVVRGVQRL
RGAPVMATDLRASASLVLAGLVAEGETLIDRIYHLDRGYEVIEEKLSALGADIRRISNTR
SVA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggataagctgctgctgcgtggcaatggccccctgcgtggtgagttgcggatttccggg
gccaaaaacgcggccttgccctgtctcgctgccaccctgctggcgcgggagccggtgcgg
ctgtgcaatattccgcatctgcgggacatcaccacgaccctggagttgttgagcacgctc
ggtgcaagggtactggtggacggccagctcgggatcgaagtcgatccacgcccggtacat
tcggtggtcgctccttatgaactggtgaagaccatgcgggcctcgatactggttctcggg
ccattgctggcccgacacggatcggcagaagtgagcctgcccggtggctgtgccatcggc
agccgcccggtgagtgtccatctcagcggcctgcaggcgttgggtgccgaaatcaccgta
gaggacggtttcgttaaagcgcaggcagcacgcctgcgcggcacgcgcatcgttatggag
atggtctccgtcaccggtacggaaaacctgctcatggcagccaccctcgccgaggggcgc
accatcctggaaaatgccgcccgcgaaccggaaatcgtcgatctcgcccgttgtctgtcc
gccatgggtgcgcgcatttccggggccggaacgtcggtcatcgagatcgagggcgtggcg
gagctgcatggcgccgaacacagtgttgtgcccgaccgcatcgagaccggtacgtacctg
gtggctgcggccatgactggcggcgacatctgcctcaaacgcaccgacgcgggcctgctg
gagagcgtcctcctcaaactgaaggaagcaggggccgaggtcacgaccggggcagacacg
atccgcatccgcatgaaacggcggccacgggcagtggatgtccgcactgcgccctttccg
gccttccccacggacatgcaggcgcagttcatggcgatgaactgcattgccgaagggagc
agcgtcgtcaccgaaaccatcttcgagaatcgcttcatgcacgtttccgagttgcaacgg
ctgggtgccgacatcaatgccgatggcaaaaccgccgtggtgcggggggtacagcgtttg
cgcggcgcccccgtgatggcaaccgatctgcgggcatcggcgtcgctggtcctggccggt
ctggtggcggagggcgaaaccctcatcgaccgcatctatcatctggatcgtggctacgag
gtcatcgaagagaagctcagcgccctcggtgcagatatccgccggataagcaacaccagg
agtgtcgcatga

DBGET integrated database retrieval system