KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2660Help
Entry
Lferr_2660        CDS       T00758                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Lferr_2660
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Lferr_2660
Enzymes [BR:afe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Lferr_2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2639264..2640685
Genome map
AA seq 473 aa AA seqDB search
MAVKTYNAGVKDYRNTYWEPDYSVKDTDILAVFKITPQAGVDREEAAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYRIEDVPGDDTCFYAFIAYPIDLFEEGSVVNVFTSLVGNVFGF
KAVRALRLEDVRFPIAYVKTCGGPPHGIQVERDIMNKYGRPLLGCTIKPKLGLSAKNYGR
ACYEGLRGGLDFTKDDENVNSQPFMRWRQRFDFVMEAIQKAEAETGERKGHYLNVTAPTP
EEMYKRAEYAKEIGAPIIMHDYITGGFCANTGLANWCRDNGMLLHIHRAMHAVLDRNPHH
GIHFRVLTKILRLSGGDHLHSGTVVGKLEGDREATLGWIDIMRDRFIKEDRSRGIFFDQD
WGSMPGVMPVASGGIHVWHMPALVTIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNRGVAIEKEGKAVLTEAAKHSPELKIAMETWKEIKFEFDTVDKLDVAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaagacctataacgcgggtgtgaaggattaccggaacacctattgggaaccg
gattacagcgtcaaggataccgatatccttgccgtgttcaagattactccccaggcgggc
gtggatcgtgaggaggccgctgctgcggttgccgccgaatcctctaccggcacctggacc
acggtgtggacggaccttctcaccgaccttgactactacaaggggcgcgcatacaggatt
gaagacgttccgggcgatgatacctgtttctatgcgttcattgcctaccccatcgatctc
ttcgaagaaggttccgtggtcaacgtcttcacctcgctggttggtaacgtcttcggcttc
aaggcggtacgtgccctgcgcctggaagacgtccgtttccccatcgcctacgtcaagacc
tgcggtgggccaccccacgggattcaggtcgaacgcgacatcatgaacaagtatggtcgc
ccattgctgggctgcaccatcaaacccaagctgggtttgtcggccaagaactatggtcgc
gcctgctatgaaggtctgcgtggtggactcgacttcactaaagatgacgaaaacgtcaat
agccagcctttcatgcgctggaggcagcgtttcgacttcgtcatggaggccatccagaag
gccgaggccgagaccggagagcgtaaggggcactacctgaacgttaccgccccgactccg
gaggaaatgtacaagcgtgcggagtacgccaaggaaatcggcgcacccatcatcatgcac
gattacatcaccggcggcttctgcgccaacacgggtctggccaactggtgccgcgacaac
ggcatgctcctgcacattcaccgcgccatgcatgcggtgctggaccgcaaccctcaccac
ggcatccacttccgtgtgctgaccaagattctccgtctgtccggcggcgatcacctgcac
tcgggtaccgtggtcggcaagctcgaaggcgaccgtgaggcgaccctgggctggatcgac
atcatgcgtgatagattcatcaaggaagatcgcagccgaggcatcttcttcgaccaggac
tggggctccatgccgggtgtgatgccggtcgcttccggtggtatccacgtttggcacatg
ccggcgctggtcaccatctttggtgatgactcggtgttgcagttcggtggcggcaccctc
ggtcatccctggggcaatgccgcaggtgctgcggccaaccgcgtcgcgctggaagcctgt
gtggaagcccgcaaccgcggtgtggccatcgagaaggaaggcaaggctgttctcactgag
gcggccaagcactcccccgaactcaagattgccatggaaacgtggaaagagatcaagttc
gaattcgatacggtcgacaagctggacgttgcccataaataa

DBGET integrated database retrieval system