KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2661Help
Entry
Lferr_2661        CDS       T00758                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Lferr_2661
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Lferr_2661
Enzymes [BR:afe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Lferr_2661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2640716..2641072
Genome map
AA seq 118 aa AA seqDB search
MSEVQDYKSRLSDPASRKFETLSYLPALTAEQIRQQVAYIVSKGWNPAVEHTEPENAFGN
YWYMWKLPMFGETDVDTILKEAEACHKANPHNHVRIVGYDNFKQSQGTSLVVYRGKTV
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtacaggattacaaatcccgtctctccgacccggcgagccggaagttcgag
acactgtcttacctgcccgccctgaccgcggagcagatccgtcaacaggttgcgtatatt
gtttccaagggctggaatccggcggtagaacataccgaaccggaaaacgccttcggcaac
tactggtatatgtggaagttgcccatgttcggcgaaacggacgtggacaccattctgaaa
gaagcggaagcctgccataaggcgaatccccataaccacgtccgtatcgtcggctatgat
aacttcaagcagtcccagggtacttccctggtagtctatcggggcaagaccgtataa

DBGET integrated database retrieval system