KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2667Help
Entry
Lferr_2667        CDS       T00758                                 

Definition
(GenBank) phosphoribosyltransferase
  KO
K02825  
pyrimidine operon attenuation protein / uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Lferr_2667
Enzymes [BR:afe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     Lferr_2667
Transcription factors [BR:afe03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Lferr_2667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2649686..2650192)
Genome map
AA seq 168 aa AA seqDB search
MTIDWDVSALLEVMARDLRPLIDPEQAAMIGIFTGGVWLARTLHAALGLRQPLGQVDISF
YRDDFSQIGLHPQVRASDIPFDVDGRDIILVDDVLYTGRTVRAAMNEIFDYGRPARILLA
VLVDRGGHELPVAADVAALRLIATAGEHIKLRGPDPLRLELEQREPQP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgactgggatgtgagcgcgctgttggaggttatggcgcgtgatctgcgcccc
ctcatcgatccggagcaggcggcgatgatcggtatttttaccggcggcgtctggctggca
cgcaccctgcacgccgcactcggtttgcggcagcccctggggcaggtggatatctctttt
tatcgcgacgacttcagccagatcggcctgcacccgcaggtgcgcgcctcggatatcccc
tttgatgtggatggccgcgatatcattctggtggacgatgtcctctacaccggccgcacc
gtgcgcgccgccatgaatgaaatcttcgattacgggcgtccggcccgcatccttctggca
gtgctggtggaccgtggcgggcacgagttgccggtagcggccgatgtggcggcgctgcgt
ctgatcgcgaccgcgggtgaacacatcaagttgcgcggtcccgatccgctgcgtctggaa
ctggagcagcgggagccgcagccatga

DBGET integrated database retrieval system