KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2668Help
Entry
Lferr_2668        CDS       T00758                                 

Definition
(GenBank) Holliday junction resolvase YqgF
  KO
K07447  putative holliday junction resolvase [EC:3.1.-.-]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
Enzymes [BR:afe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Lferr_2668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvX
Motif
Other DBs
NCBI-ProteinID: ACH84862
JGI: Lferr2668
UniProt: B5EQG5
Position
complement(2650189..2650620)
Genome map
AA seq 143 aa AA seqDB search
MPERSGPLLGIDFGERRIGIAVLGESGLAPQGVATLRNGECGPDWDGFARILKEWQPRAL
VLGLPLHMDGSEGFMVGRVRKFAESLQRRFPLPIHWVDERLSSHAADLVLKERELSHKKR
GRLLDQAAACEILWTFHNAGGDA
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcgcagcgggcctctgctcgggatagacttcggggagcgccggatcgggatt
gcggttctgggggagtcgggcctggcgccgcaaggggttgccaccctgcgcaatggcgag
tgtggccccgactgggatggcttcgcccgcattctcaaagaatggcagccccgcgccctg
gtcctgggcctgcccctgcacatggatggcagtgaggggttcatggttggccgggtgcgc
aaatttgcggaaagtttgcagcgccgtttccccttgcccatccattgggtggatgaacgg
ctgagcagccatgccgcggatctggtcctgaaggagcgcgagctttcccacaagaagcgc
ggtcgcctgctggatcaggccgcagcctgcgaaattttgtggacctttcataatgccgga
ggcgacgcatga

DBGET integrated database retrieval system