KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2673Help
Entry
Lferr_2673        CDS       T00758                                 

Definition
(GenBank) iron-sulfur cluster assembly accessory protein
  KO
K15724  iron-sulfur cluster insertion protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-S_biosyn Arena_ncap_C
Motif
Other DBs
NCBI-ProteinID: ACH84867
JGI: Lferr2673
UniProt: B5EQH0
Position
complement(2654848..2655222)
Genome map
AA seq 124 aa AA seqDB search
MMSTATETMTDLDSIPPVMTLTQNAADKIASLIEEEGSDDLKLRVFVTGGGCSGFQYGFT
FDENMNEGDTEVHQLGVSLLIDPMSYQYLVGAEIDYSEGLEGAQFVIKNPNATTTCGCGS
SFSA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcacagcaacggaaacgatgacggatctggattccattcccccggtcatgacc
ttgacacaaaatgcagcggacaaaatcgcgtcgctcattgaagaggaaggttctgacgat
ctgaagctgcgcgtctttgtgacggggggcggttgttccggttttcagtatggcttcact
ttcgatgagaatatgaacgaaggcgatacggaagtgcaccaattgggtgtgagtctgctg
attgatcccatgagttatcagtacctggtcggagcggagattgactacagcgaggggttg
gaaggcgcgcaattcgtcatcaaaaaccccaacgccacgaccacctgcggttgcggatct
tccttttcggcctga

DBGET integrated database retrieval system