KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2674Help
Entry
Lferr_2674        CDS       T00758                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00010  Glycolysis / Gluconeogenesis
afe00020  Citrate cycle (TCA cycle)
afe00260  Glycine, serine and threonine metabolism
afe00280  Valine, leucine and isoleucine degradation
afe00620  Pyruvate metabolism
afe00630  Glyoxylate and dicarboxylate metabolism
afe00640  Propanoate metabolism
afe01100  Metabolic pathways
afe01110  Biosynthesis of secondary metabolites
afe01120  Microbial metabolism in diverse environments
afe01130  Biosynthesis of antibiotics
afe01200  Carbon metabolism
Module
afe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lferr_2674
   00020 Citrate cycle (TCA cycle)
    Lferr_2674
   00620 Pyruvate metabolism
    Lferr_2674
   00630 Glyoxylate and dicarboxylate metabolism
    Lferr_2674
   00640 Propanoate metabolism
    Lferr_2674
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lferr_2674
   00280 Valine, leucine and isoleucine degradation
    Lferr_2674
Enzymes [BR:afe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Lferr_2674
Exosome [BR:afe04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Lferr_2674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 2-oxoacid_dh Biotin_lipoyl Pyr_redox_dim Pyr_redox Pyr_redox_3 E3_binding 3HCDH_N 2-Hacid_dh_C FAD_binding_3 NAD_binding_8 Shikimate_DH NAD_binding_7 GIDA AlaDh_PNT_C TrkA_N HI0933_like Thi4 NAD_binding_2 FAD_binding_2 FAD_oxidored Ribosomal_S11 NAD_Gly3P_dh_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACH84868
JGI: Lferr2674
UniProt: B5EQH1
Position
complement(2655352..2658303)
Genome map
AA seq 983 aa AA seqDB search
MAEPYVIKMPQLSDTMTEGVLVSWEKPAGARVERGDVVATVETDKAIMDVEVFRSGYLAG
PLAEANSVIPVGGTIGYITDSAVETVAAPVPAAPAVVPTGPASATPPAPEGYAVKMPQLS
DTMTEGVLVSWEKAPGDRIQRGDVVATVETDKAIMDVEVFREGYLSGPLVAVDAVVPVGE
AIAWLVESPEQVSHENAVHDGGLRQPDATSAPVATPLPAAAMSGPVPGADPAPRPQQGAA
SPFARQLAGQRGVDINGLRGTGPAGVIVAADVLGAAGGRAAPVASSGTAEPAVPGNGRAM
TAIERAISQAMAASLSIPVFHVTVQVRPEALIRAAKAHKLSVTVAIAKAASQALHRHPLV
NAAYQPVDKIVERSQHDIGIAATTEDGGLIVPVLRGVEGKTPEQLQTEWTSLLEKARKRR
LSPPEYTNPTFTISNMGMYGIAQFDAIVTPGTAAIIAIAGNGPEGMPITITADHRVVNGA
EAALFLNDLKQAIEHPENWLGSGGPVIPEGDYDVQVLVIGAGPGGEDCARELAENGIRVA
MVNDAPLPGGECLWRGCIPSKAWRAAADRIRDREHDAAMGITLGTPRLDWAQLEQHRRGI
LQTRGEMALKTDQGVKIQVLEGYARFTGDHSVEISGKDARTLTFGACVIATGAPAFVPPI
PGIQDALKSGAAVTSDTVWNLKQPPARLCVIGAGAIGMEMAQMFHDFGAEVRVLEALPRP
VAEMEKEVAEQLMKAIAHNSLRLQVLTGVKVTEVAGQPGQLEVRYQSGDEAANYACDLLL
VATGKRPDTSGLNLAAAGVALGDRAVIAVDASGRTNVPHIYAVGDVIGGYMLAHTAGQQG
RVAAASLLGHSARYEAAKDCGVTFTRPQCAFVGLSLEQARAEGIDAVEVKVPLSIDAKAM
MTGETDGLIKIVADKISHRIVGVHFLADHADTLVGEAVMMVSAGLTLEQVAGAIHPHPTQ
TELFGEMARRLLSRLRRSARAAS
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaccttacgtcatcaaaatgccgcaactttccgacaccatgacggaaggtgtc
cttgtatcctgggagaagcctgcgggcgcgcgggtagagcgtggcgacgtggtggcgacg
gtggaaacggacaaggccatcatggatgtcgaggtgtttcgttccggttacctggcgggg
cccctggccgaggccaacagtgtcattccggtgggcgggactatcggctatatcaccgat
agcgcggtggaaacggtggcagcgcctgttcctgcagcgcctgcggtcgtgccgacgggg
ccggcatccgctacgccacccgcccctgagggctatgcggtgaagatgccgcagctctcc
gacaccatgaccgaaggtgtgctggtatcctgggaaaaggcaccgggggacaggatacag
cgcggggatgtggtggcgacggtggaaacggacaaggccatcatggacgtggaagtgttc
cgtgagggatacctgtcgggtcctttggtggccgtggatgcggtggtgcccgtaggagag
gccatcgcctggctagtggagtcaccggagcaggtaagccacgaaaacgctgtccatgac
ggagggctgcgccagcccgatgcgacatcggcgccggtagcgactcccttgcctgctgcc
gccatgtctggcccagtaccgggcgcagatccggcgccgcgtccgcagcaaggggccgcc
agcccctttgcccggcagttggcgggccagcgaggtgtggatatcaacgggctgcgcggt
acggggccagcgggcgtgatcgtcgccgcagatgttctcggcgctgctggtggccgtgca
gccccggtcgcgtcgagcggtactgccgagcccgcggtgcccggtaacggccgcgccatg
acggccatcgaaagagcgatcagccaggcgatggccgcttccctgagtattccggttttt
catgtcaccgtgcaggtcaggcccgaggcgctgatccgcgccgccaaggcacacaagctt
tccgtcacggtggcgatcgccaaggccgcttcgcaggcgttgcaccgacaccctctggtg
aatgccgcttatcagcctgtggataagattgtcgaacgcagtcagcatgacatcggcatt
gccgcgactacggaagacggtggtctgattgtgcctgtcctgcgcggtgtcgaaggcaag
acgccggagcagttgcagacggagtggacctcattgctggagaaggcgcgcaaacgtcgt
ctcagtccacctgaatataccaaccctacctttaccatctcgaacatggggatgtacggc
attgcccagttcgatgccatcgtcaccccggggacggcggccatcattgcgatcgccggg
aatggacccgaaggcatgcccatcaccatcacggcagaccaccgggtggtcaatggcgcc
gaggcggcgctgttcctcaatgacctgaaacaggccattgagcatcccgagaactggctg
ggtagcggcggcccggtgattcccgaaggggattacgacgtgcaagtgctggtcatcggc
gcaggccccggcggcgaagactgcgcccgcgagctcgcagagaacggtatcagggtggcc
atggtcaacgatgcgcccctgccgggcggcgaatgtctgtggcggggctgcattccctcc
aaggcttggcgcgctgctgcggatcgcatccgcgaccgcgagcacgacgcggcgatgggc
attaccctgggcactcccaggctggattgggcacaactggaacagcatcggcgcggtatt
ctccagacccgcggagaaatggccctgaaaaccgatcagggtgtgaaaattcaggtgctg
gaaggctatgcccgtttcaccggtgaccacagcgtcgagatcagcggcaaggatgcgcgg
accctgaccttcggagcctgtgtcattgctacgggcgcacccgcctttgtgccgccgatt
cccggcattcaggacgcgttgaagagtggtgcggcggtgacttccgatacggtctggaac
ctgaaacagccgcccgcgcgcctctgcgtcatcggcgccggcgccatcggtatggaaatg
gcgcagatgttccacgacttcggcgccgaagtgcgggtactggaagccctgccacggccg
gtggccgagatggaaaaggaagtcgccgaacagttgatgaaggccatcgcccataacagc
ctgcgtttgcaggtgctgaccggagtcaaggtgacggaggtcgcggggcaacccggccag
ttggaggtgcgttaccagtcaggcgacgaggcggcgaattatgcctgtgatctgctgctg
gtggcgacgggtaagcgcccggataccagtgggctgaatctggccgcggccggtgtggct
ttgggagatcgcgccgtcatcgccgtcgatgcctccgggcgcaccaatgtgccccatatc
tatgcggtcggtgatgtcatcggcggctacatgctggcccacaccgccggtcagcaggga
cgggtggcggccgccagtttgcttggccacagcgctcgttatgaagcggctaaagactgc
ggggtgaccttcacccggccccagtgcgcgtttgtcggcctttccctggagcaggccagg
gcggaagggatcgacgcggtcgaggtcaaggtgcccctgagcatcgatgccaaggccatg
atgaccggcgagaccgacggactgatcaagatcgtcgccgacaagatcagccaccgtatc
gtcggtgtgcatttcctcgccgatcatgccgataccctggtgggcgaggccgtgatgatg
gtcagcgccggtttgaccctggagcaggtggctggcgccattcatccccatccgactcag
accgaactcttcggcgaaatggcgcgacgcctgttatcccgcctgcggcgcagtgcccgg
gcggcgagctga

DBGET integrated database retrieval system